BLASTX nr result
ID: Lithospermum23_contig00050156
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00050156 (532 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP10449.1 unnamed protein product [Coffea canephora] 58 1e-06 >CDP10449.1 unnamed protein product [Coffea canephora] Length = 869 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = -1 Query: 529 KPRKCTLESNIYDFVYNNETGLVTFNLDDMPAENKKV 419 KPRKCT+ S++ DF Y++ +GLVTFNLDDMP+E++KV Sbjct: 826 KPRKCTVGSSMIDFAYDSSSGLVTFNLDDMPSEDQKV 862