BLASTX nr result
ID: Lithospermum23_contig00049828
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00049828 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010680862.1 PREDICTED: uncharacterized protein LOC104895914 [... 55 1e-06 >XP_010680862.1 PREDICTED: uncharacterized protein LOC104895914 [Beta vulgaris subsp. vulgaris] Length = 768 Score = 55.5 bits (132), Expect = 1e-06 Identities = 23/70 (32%), Positives = 44/70 (62%), Gaps = 1/70 (1%) Frame = -3 Query: 310 LPLTLTIALHEKEEIV-IGYLEQQEHFMWLKMCKDFPLQPIHSNWRHHCDDSITELSSRY 134 LP+ H + ++ +G+L++ EH++ ++M +DFP+ PI+ WRHH D S+ S Y Sbjct: 682 LPIIAREGNHAPDRVITLGFLQRMEHYVVVEMKEDFPMPPIYPYWRHHHDPSVAGWSITY 741 Query: 133 STRLQKFREI 104 +R ++++ I Sbjct: 742 HSRFERWKVI 751