BLASTX nr result
ID: Lithospermum23_contig00049784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00049784 (303 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIT21134.1 hypothetical protein A4A49_59463, partial [Nicotiana ... 54 2e-06 OIT01206.1 hypothetical protein A4A49_59776, partial [Nicotiana ... 52 8e-06 >OIT21134.1 hypothetical protein A4A49_59463, partial [Nicotiana attenuata] Length = 222 Score = 53.9 bits (128), Expect = 2e-06 Identities = 27/50 (54%), Positives = 32/50 (64%) Frame = -3 Query: 163 GILGQSPSMPPPLKASSKCQIWGLYNHDALDCNVLFNHAYASNKLHKSLA 14 GILG SP P P K +CQI YNH AL+C FNH+Y SN + KS+A Sbjct: 140 GILGHSPFTPNPAK---QCQICFHYNHTALECKNRFNHSYVSNSIPKSIA 186 >OIT01206.1 hypothetical protein A4A49_59776, partial [Nicotiana attenuata] Length = 214 Score = 52.0 bits (123), Expect = 8e-06 Identities = 27/50 (54%), Positives = 31/50 (62%) Frame = -3 Query: 163 GILGQSPSMPPPLKASSKCQIWGLYNHDALDCNVLFNHAYASNKLHKSLA 14 GILG SP P P K +CQI YNH AL+C FNH Y SN + KS+A Sbjct: 132 GILGHSPFTPNPAK---QCQICFHYNHIALECKNRFNHFYVSNSIPKSIA 178