BLASTX nr result
ID: Lithospermum23_contig00049759
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00049759 (245 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP06304.1 unnamed protein product [Coffea canephora] 53 4e-06 >CDP06304.1 unnamed protein product [Coffea canephora] Length = 879 Score = 52.8 bits (125), Expect = 4e-06 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = -1 Query: 143 AATVGEVDLLAEFLMACPSSVEDLT-CGESVVHVAVRDRCRGSFEVIF 3 AA V E+D LAEFLM CP+S+ED+T C E+ +H+AV++ +F+V+F Sbjct: 561 AAEVEEIDFLAEFLMKCPASIEDVTLCCETALHIAVKNGKLRAFKVLF 608