BLASTX nr result
ID: Lithospermum23_contig00049391
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00049391 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH90706.1 hypothetical protein Ccrd_007295, partial [Cynara car... 52 1e-05 >KVH90706.1 hypothetical protein Ccrd_007295, partial [Cynara cardunculus var. scolymus] Length = 1561 Score = 52.0 bits (123), Expect = 1e-05 Identities = 30/67 (44%), Positives = 40/67 (59%) Frame = -2 Query: 206 AGNSMYRISNTLLLAYDEEGNARTTTGDDDRLLEKLVKHDCRYILSGCLTNLPYIITEEC 27 + NSMYRI+ T+LL+Y +A T + L EKL IL+ CLTNLP +I +C Sbjct: 1367 SANSMYRITETILLSY----HANTNEVSQEELFEKLSSMIAD-ILAACLTNLPRLIAIKC 1421 Query: 26 HTYTMEK 6 HT +EK Sbjct: 1422 HTSAIEK 1428