BLASTX nr result
ID: Lithospermum23_contig00048977
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00048977 (287 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AGC78926.1 hypothetical protein (mitochondrion) [Vicia faba] AGC... 79 3e-17 >AGC78926.1 hypothetical protein (mitochondrion) [Vicia faba] AGC79029.1 hypothetical protein (mitochondrion) [Vicia faba] Length = 102 Score = 79.3 bits (194), Expect = 3e-17 Identities = 41/54 (75%), Positives = 43/54 (79%) Frame = -3 Query: 282 VPVPKRPELGKASPMLEGFTVLLTSSPDPFCARIDAILDVHSSRLPTLFSLGEG 121 V P+ LGKAS MLEGFT LLTSSPD FCAR+DAI DVHSS LPTLFSL EG Sbjct: 48 VEFPQFQYLGKASLMLEGFTALLTSSPDQFCARLDAISDVHSSSLPTLFSLREG 101