BLASTX nr result
ID: Lithospermum23_contig00048845
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00048845 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP03627.1 unnamed protein product [Coffea canephora] 56 1e-06 >CDP03627.1 unnamed protein product [Coffea canephora] Length = 318 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/59 (52%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = +1 Query: 1 ALGKIEAYESLKDTVTHLKDIVLVSSLGRATEAAISMASQGTLGKSCLTGTP-NGATEP 174 A GK+EAYE +KD +LKD+VLVS L +ATEAAI+ ++Q + K L T NGA P Sbjct: 240 ACGKVEAYEKMKDVFGNLKDMVLVSQLEKATEAAINFSAQAAVSKLNLPETTINGAAVP 298