BLASTX nr result
ID: Lithospermum23_contig00048714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00048714 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP07101.1 unnamed protein product [Coffea canephora] 78 4e-15 XP_006340186.1 PREDICTED: GATA transcription factor 11-like [Sol... 75 8e-14 XP_019066596.1 PREDICTED: GATA transcription factor 8-like isofo... 72 3e-13 XP_015058777.1 PREDICTED: GATA transcription factor 11 [Solanum ... 72 6e-13 XP_004251141.1 PREDICTED: GATA transcription factor 11-like isof... 72 6e-13 XP_016547861.1 PREDICTED: GATA transcription factor 11-like [Cap... 65 2e-10 XP_011089286.1 PREDICTED: GATA transcription factor 11-like [Ses... 64 6e-10 XP_019240882.1 PREDICTED: GATA transcription factor 11-like isof... 60 1e-08 NP_001313191.1 GATA transcription factor 11-like [Nicotiana taba... 60 1e-08 XP_009795846.1 PREDICTED: GATA transcription factor 11-like isof... 60 1e-08 XP_009621794.1 PREDICTED: GATA transcription factor 11-like isof... 60 1e-08 XP_019240881.1 PREDICTED: GATA transcription factor 11-like isof... 60 1e-08 XP_009795845.1 PREDICTED: GATA transcription factor 11-like isof... 60 1e-08 XP_009621793.1 PREDICTED: GATA transcription factor 11-like isof... 60 1e-08 XP_019178239.1 PREDICTED: GATA transcription factor 11-like [Ipo... 60 2e-08 XP_019166505.1 PREDICTED: GATA transcription factor 11-like [Ipo... 58 1e-07 XP_017248640.1 PREDICTED: GATA transcription factor 11-like [Dau... 53 5e-06 KZM95560.1 hypothetical protein DCAR_018802 [Daucus carota subsp... 53 5e-06 >CDP07101.1 unnamed protein product [Coffea canephora] Length = 316 Score = 78.2 bits (191), Expect = 4e-15 Identities = 36/62 (58%), Positives = 46/62 (74%) Frame = +3 Query: 9 ETSALQTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIACA 188 E+ + QT SP SVLES G+CS G+SLPI+ ++VIPVR RSK RPS +NPW PI+CA Sbjct: 120 ESGSFQTHSPVSVLESGGSCSGGKSLPIKPDIVIPVRTRSKRARPSAINPWFVMAPISCA 179 Query: 189 VA 194 + Sbjct: 180 AS 181 >XP_006340186.1 PREDICTED: GATA transcription factor 11-like [Solanum tuberosum] Length = 337 Score = 74.7 bits (182), Expect = 8e-14 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 6/95 (6%) Frame = +3 Query: 12 TSALQTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIA--- 182 T QT SP SVLE S +CS G+S+PI+ ++VIPVR RSK RPS VNPWV PI+ Sbjct: 100 TGTFQTQSPVSVLEGSNSCSGGKSIPIKHDIVIPVRPRSKRARPSAVNPWVLMAPISSTR 159 Query: 183 CAVAKMSSGSIPIKKRPRTSQV---PEGLKGSIQQ 278 A K+S +KR R S + E +K +QQ Sbjct: 160 VASKKISDARKTKEKRRRLSLLSGAKEPMKNYVQQ 194 >XP_019066596.1 PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum lycopersicum] Length = 272 Score = 72.4 bits (176), Expect = 3e-13 Identities = 44/95 (46%), Positives = 55/95 (57%), Gaps = 6/95 (6%) Frame = +3 Query: 12 TSALQTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIAC-- 185 T QT SP SVLE S +CS G+S+PI+ + VIPVR RSK RPS VNPWV PI+ Sbjct: 34 TGTFQTQSPVSVLEGSNSCSGGKSVPIKHDPVIPVRPRSKRARPSAVNPWVLMAPISSTR 93 Query: 186 AVAKMSSGSIPIKKRPR----TSQVPEGLKGSIQQ 278 +K S + K+R R S E +K +QQ Sbjct: 94 VASKKISDARKTKERRRRLSLLSGAKEPMKNYVQQ 128 >XP_015058777.1 PREDICTED: GATA transcription factor 11 [Solanum pennellii] Length = 336 Score = 72.4 bits (176), Expect = 6e-13 Identities = 44/95 (46%), Positives = 55/95 (57%), Gaps = 6/95 (6%) Frame = +3 Query: 12 TSALQTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIAC-- 185 T QT SP SVLE S +CS G+S+PI+ + VIPVR RSK RPS VNPWV PI+ Sbjct: 98 TGTFQTQSPVSVLEGSNSCSGGKSVPIKHDPVIPVRPRSKRARPSAVNPWVLMAPISSTR 157 Query: 186 AVAKMSSGSIPIKKRPR----TSQVPEGLKGSIQQ 278 +K S + K+R R S E +K +QQ Sbjct: 158 VASKKISDARKTKERRRRLSLLSGAKEPMKNYVQQ 192 >XP_004251141.1 PREDICTED: GATA transcription factor 11-like isoform X2 [Solanum lycopersicum] Length = 336 Score = 72.4 bits (176), Expect = 6e-13 Identities = 44/95 (46%), Positives = 55/95 (57%), Gaps = 6/95 (6%) Frame = +3 Query: 12 TSALQTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIAC-- 185 T QT SP SVLE S +CS G+S+PI+ + VIPVR RSK RPS VNPWV PI+ Sbjct: 98 TGTFQTQSPVSVLEGSNSCSGGKSVPIKHDPVIPVRPRSKRARPSAVNPWVLMAPISSTR 157 Query: 186 AVAKMSSGSIPIKKRPR----TSQVPEGLKGSIQQ 278 +K S + K+R R S E +K +QQ Sbjct: 158 VASKKISDARKTKERRRRLSLLSGAKEPMKNYVQQ 192 >XP_016547861.1 PREDICTED: GATA transcription factor 11-like [Capsicum annuum] Length = 337 Score = 65.1 bits (157), Expect = 2e-10 Identities = 34/60 (56%), Positives = 40/60 (66%), Gaps = 3/60 (5%) Frame = +3 Query: 12 TSALQTDSPNSVLESSGTCSPGESLPIRV---EMVIPVRARSKLGRPSNVNPWVQKTPIA 182 T QT SP SVLE S +CS G+S+PI+ + VIPVR RSK RPS VNPWV PI+ Sbjct: 97 TGTFQTQSPVSVLEGSNSCSGGKSIPIKPIKHDTVIPVRPRSKRARPSAVNPWVLMAPIS 156 >XP_011089286.1 PREDICTED: GATA transcription factor 11-like [Sesamum indicum] Length = 336 Score = 63.9 bits (154), Expect = 6e-10 Identities = 39/105 (37%), Positives = 55/105 (52%), Gaps = 16/105 (15%) Frame = +3 Query: 9 ETSALQTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIACA 188 E+ QT SP SVLES G+CS G++LPI+ IPVR RSK R + +NPW+ +P A Sbjct: 119 ESGFFQTQSPVSVLESGGSCSAGKNLPIKSHNAIPVRTRSKRVRHAGINPWLLVSPWFAA 178 Query: 189 VA----------------KMSSGSIPIKKRPRTSQVPEGLKGSIQ 275 + K+S S+ +K T PE ++ S+Q Sbjct: 179 TSTSKRTSNARKHKEARKKLSQPSVVVKS---TRDSPEKVENSLQ 220 >XP_019240882.1 PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana attenuata] Length = 305 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 24 QTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIA 182 QT SP SVLESS +CS G+S+ I+ ++ IPVR RSK R S +NPW+ PI+ Sbjct: 101 QTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWILMPPIS 153 >NP_001313191.1 GATA transcription factor 11-like [Nicotiana tabacum] CAC28528.1 GATA-1 zinc finger protein [Nicotiana tabacum] Length = 305 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 24 QTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIA 182 QT SP SVLESS +CS G+S+ I+ ++ IPVR RSK R S +NPW+ PI+ Sbjct: 101 QTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWILMPPIS 153 >XP_009795846.1 PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana sylvestris] Length = 305 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 24 QTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIA 182 QT SP SVLESS +CS G+S+ I+ ++ IPVR RSK R S +NPW+ PI+ Sbjct: 101 QTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWILMPPIS 153 >XP_009621794.1 PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana tomentosiformis] XP_016465978.1 PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana tabacum] Length = 305 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 24 QTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIA 182 QT SP SVLESS +CS G+S+ I+ ++ IPVR RSK R S +NPW+ PI+ Sbjct: 101 QTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWILMPPIS 153 >XP_019240881.1 PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana attenuata] OIT19906.1 gata transcription factor 11 [Nicotiana attenuata] Length = 306 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 24 QTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIA 182 QT SP SVLESS +CS G+S+ I+ ++ IPVR RSK R S +NPW+ PI+ Sbjct: 102 QTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWILMPPIS 154 >XP_009795845.1 PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana sylvestris] XP_016514725.1 PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana tabacum] Length = 306 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 24 QTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIA 182 QT SP SVLESS +CS G+S+ I+ ++ IPVR RSK R S +NPW+ PI+ Sbjct: 102 QTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWILMPPIS 154 >XP_009621793.1 PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana tomentosiformis] XP_016465977.1 PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana tabacum] Length = 306 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 24 QTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIA 182 QT SP SVLESS +CS G+S+ I+ ++ IPVR RSK R S +NPW+ PI+ Sbjct: 102 QTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWILMPPIS 154 >XP_019178239.1 PREDICTED: GATA transcription factor 11-like [Ipomoea nil] Length = 324 Score = 59.7 bits (143), Expect = 2e-08 Identities = 32/84 (38%), Positives = 49/84 (58%) Frame = +3 Query: 9 ETSALQTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIACA 188 E QT SP SVLESS +CS G+++P++ + +PVR R+K RPS NPW+ + I+ + Sbjct: 110 EAVMFQTQSPVSVLESSASCSGGKAIPVKTGVAVPVRTRTKRTRPS-TNPWLLASLISSS 168 Query: 189 VAKMSSGSIPIKKRPRTSQVPEGL 260 A S + K+R V + + Sbjct: 169 TAFESRKTSAAKRRRERKLVQKSI 192 >XP_019166505.1 PREDICTED: GATA transcription factor 11-like [Ipomoea nil] Length = 326 Score = 57.8 bits (138), Expect = 1e-07 Identities = 32/70 (45%), Positives = 46/70 (65%), Gaps = 2/70 (2%) Frame = +3 Query: 9 ETSALQTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPIACA 188 + QT SP SVLE+S + S G+++PI+ ++ IPVR RSK RP+ VNPW+ P++ Sbjct: 119 QPGVFQTQSPVSVLETSISYSGGKTVPIKSDITIPVRTRSKRARPA-VNPWILIPPLSST 177 Query: 189 VA--KMSSGS 212 A K SSG+ Sbjct: 178 AASKKTSSGA 187 >XP_017248640.1 PREDICTED: GATA transcription factor 11-like [Daucus carota subsp. sativus] Length = 460 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = +3 Query: 15 SALQTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPI 179 S LQT S NSVLESS +CS G++L E+++PVRAR+K+ R W +P+ Sbjct: 123 SLLQTPSQNSVLESSSSCSAGKNLSTSCELLVPVRARTKIPRSLTFTRWHLLSPL 177 >KZM95560.1 hypothetical protein DCAR_018802 [Daucus carota subsp. sativus] Length = 730 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = +3 Query: 15 SALQTDSPNSVLESSGTCSPGESLPIRVEMVIPVRARSKLGRPSNVNPWVQKTPI 179 S LQT S NSVLESS +CS G++L E+++PVRAR+K+ R W +P+ Sbjct: 393 SLLQTPSQNSVLESSSSCSAGKNLSTSCELLVPVRARTKIPRSLTFTRWHLLSPL 447