BLASTX nr result
ID: Lithospermum23_contig00048633
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00048633 (231 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015903113.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 3e-06 XP_010101919.1 hypothetical protein L484_001710 [Morus notabilis... 53 3e-06 >XP_015903113.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Ziziphus jujuba] Length = 583 Score = 52.8 bits (125), Expect = 3e-06 Identities = 20/35 (57%), Positives = 31/35 (88%) Frame = +2 Query: 125 MQQKLVNVLQKCQNVRQIKQTHDQIIVHGLKDCNF 229 M+QKL+ +L+ C+N+R++KQTH QI++HGLKD +F Sbjct: 1 MEQKLLQILKSCKNLRELKQTHVQILIHGLKDSDF 35 >XP_010101919.1 hypothetical protein L484_001710 [Morus notabilis] EXB90556.1 hypothetical protein L484_001710 [Morus notabilis] Length = 616 Score = 52.8 bits (125), Expect = 3e-06 Identities = 21/35 (60%), Positives = 31/35 (88%) Frame = +2 Query: 125 MQQKLVNVLQKCQNVRQIKQTHDQIIVHGLKDCNF 229 M+ KLV VL++C+++R++KQTH QI+VHGL+ CNF Sbjct: 1 MEHKLVEVLKRCKSLRELKQTHLQILVHGLQHCNF 35