BLASTX nr result
ID: Lithospermum23_contig00048602
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00048602 (264 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDO96993.1 unnamed protein product [Coffea canephora] 78 7e-15 XP_019244319.1 PREDICTED: endoglucanase 24-like [Nicotiana atten... 74 2e-13 XP_016502270.1 PREDICTED: endoglucanase 24-like [Nicotiana tabacum] 74 2e-13 XP_009802572.1 PREDICTED: endoglucanase 24-like [Nicotiana sylve... 74 2e-13 XP_009631305.1 PREDICTED: endoglucanase 24-like [Nicotiana tomen... 74 2e-13 XP_002305460.2 hypothetical protein POPTR_0004s16900g [Populus t... 74 2e-13 XP_011088486.1 PREDICTED: endoglucanase 24-like [Sesamum indicum] 73 4e-13 XP_019165450.1 PREDICTED: endoglucanase 24-like [Ipomoea nil] 73 4e-13 XP_011037198.1 PREDICTED: endoglucanase 24-like [Populus euphrat... 73 4e-13 KZM84873.1 hypothetical protein DCAR_027705 [Daucus carota subsp... 72 5e-13 XP_012837113.1 PREDICTED: endoglucanase 24-like [Erythranthe gut... 72 8e-13 APR63857.1 endo-1,4-beta-glucanase B10 [Populus tomentosa] 72 8e-13 AFZ78638.1 korrigan [Populus tomentosa] 72 8e-13 XP_006379262.1 cellulase family protein [Populus trichocarpa] AE... 72 8e-13 XP_017223002.1 PREDICTED: endoglucanase 6-like [Daucus carota su... 72 8e-13 OIT19036.1 endoglucanase 24 [Nicotiana attenuata] 69 9e-13 EEF49493.1 endo-1,4-beta-glucanase, putative [Ricinus communis] 72 1e-12 XP_015570723.1 PREDICTED: endoglucanase 24 [Ricinus communis] 72 1e-12 OMO74401.1 Glycoside hydrolase, family 9 [Corchorus capsularis] 72 1e-12 OMO75530.1 Glycoside hydrolase, family 9 [Corchorus olitorius] 72 1e-12 >CDO96993.1 unnamed protein product [Coffea canephora] Length = 499 Score = 77.8 bits (190), Expect = 7e-15 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 122 YPSSYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 Y +SYHEYG+ALSK ILFFE QRSG+LP DQR+SWR HSGLGD Sbjct: 29 YKASYHEYGEALSKCILFFEGQRSGFLPQDQRMSWRGHSGLGD 71 >XP_019244319.1 PREDICTED: endoglucanase 24-like [Nicotiana attenuata] OIT07084.1 endoglucanase 24 [Nicotiana attenuata] Length = 494 Score = 73.6 bits (179), Expect = 2e-13 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 131 SYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SYH+Y DAL+KSILFFE QRSGYLP DQR++WR HSGLGD Sbjct: 24 SYHDYTDALTKSILFFEGQRSGYLPQDQRMNWRGHSGLGD 63 >XP_016502270.1 PREDICTED: endoglucanase 24-like [Nicotiana tabacum] Length = 494 Score = 73.6 bits (179), Expect = 2e-13 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 131 SYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SYH+Y DAL+KSILFFE QRSGYLP DQR++WR HSGLGD Sbjct: 24 SYHDYTDALTKSILFFEGQRSGYLPQDQRMNWRGHSGLGD 63 >XP_009802572.1 PREDICTED: endoglucanase 24-like [Nicotiana sylvestris] Length = 494 Score = 73.6 bits (179), Expect = 2e-13 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 131 SYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SYH+Y DAL+KSILFFE QRSGYLP DQR++WR HSGLGD Sbjct: 24 SYHDYTDALTKSILFFEGQRSGYLPQDQRMNWRGHSGLGD 63 >XP_009631305.1 PREDICTED: endoglucanase 24-like [Nicotiana tomentosiformis] XP_016475811.1 PREDICTED: endoglucanase 24-like [Nicotiana tabacum] Length = 494 Score = 73.6 bits (179), Expect = 2e-13 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 131 SYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SYH+Y DAL+KSILFFE QRSGYLP DQR++WR HSGLGD Sbjct: 24 SYHDYTDALTKSILFFEGQRSGYLPQDQRMNWRGHSGLGD 63 >XP_002305460.2 hypothetical protein POPTR_0004s16900g [Populus trichocarpa] EEE85971.2 hypothetical protein POPTR_0004s16900g [Populus trichocarpa] Length = 496 Score = 73.6 bits (179), Expect = 2e-13 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +2 Query: 122 YPSSYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 + SSYHEY DALSKSILFFE QRSGYLP DQR++WR +SGL D Sbjct: 23 FQSSYHEYQDALSKSILFFEGQRSGYLPQDQRVTWRANSGLSD 65 >XP_011088486.1 PREDICTED: endoglucanase 24-like [Sesamum indicum] Length = 490 Score = 72.8 bits (177), Expect = 4e-13 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +2 Query: 131 SYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SYH+Y DALSKSI+FFE QRSGYLP DQR++WR +SGLGD Sbjct: 21 SYHDYADALSKSIMFFEGQRSGYLPADQRLAWRGNSGLGD 60 >XP_019165450.1 PREDICTED: endoglucanase 24-like [Ipomoea nil] Length = 496 Score = 72.8 bits (177), Expect = 4e-13 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +2 Query: 128 SSYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SSYH Y DALSK ILFFE QRSGYLP++QR++WR HSGLGD Sbjct: 25 SSYHNYPDALSKCILFFEGQRSGYLPSEQRMTWRGHSGLGD 65 >XP_011037198.1 PREDICTED: endoglucanase 24-like [Populus euphratica] Length = 496 Score = 72.8 bits (177), Expect = 4e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +2 Query: 128 SSYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SSYHEY DALSKSILFFE QRSGYLP DQR++WR +SGL D Sbjct: 25 SSYHEYQDALSKSILFFEGQRSGYLPQDQRVTWRANSGLSD 65 >KZM84873.1 hypothetical protein DCAR_027705 [Daucus carota subsp. sativus] Length = 314 Score = 72.0 bits (175), Expect = 5e-13 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +2 Query: 137 HEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGDVEDV 262 H YGDALSKSILFFEAQRSGYLP+ QRI WR HSGL D + V Sbjct: 27 HNYGDALSKSILFFEAQRSGYLPSSQRIKWRGHSGLNDGKSV 68 >XP_012837113.1 PREDICTED: endoglucanase 24-like [Erythranthe guttata] EYU37857.1 hypothetical protein MIMGU_mgv1a005277mg [Erythranthe guttata] Length = 490 Score = 72.0 bits (175), Expect = 8e-13 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +2 Query: 131 SYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SYH+Y DAL+KSILFFE QRSGYLP DQR++WR +SGLGD Sbjct: 22 SYHDYSDALTKSILFFEGQRSGYLPADQRMTWRGNSGLGD 61 >APR63857.1 endo-1,4-beta-glucanase B10 [Populus tomentosa] Length = 496 Score = 72.0 bits (175), Expect = 8e-13 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +2 Query: 122 YPSSYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 + SSYHEY +ALSKSILFFE QRSGYLP DQR++WR +SGL D Sbjct: 23 FQSSYHEYQEALSKSILFFEGQRSGYLPQDQRVTWRANSGLSD 65 >AFZ78638.1 korrigan [Populus tomentosa] Length = 496 Score = 72.0 bits (175), Expect = 8e-13 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +2 Query: 122 YPSSYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 + SSYHEY +ALSKSILFFE QRSGYLP DQR++WR +SGL D Sbjct: 23 FQSSYHEYQEALSKSILFFEGQRSGYLPQDQRVTWRANSGLSD 65 >XP_006379262.1 cellulase family protein [Populus trichocarpa] AEO97197.1 endo-1,4-beta-glucanase [Populus trichocarpa] AEO97224.1 endo-1,4-beta-glucanase [Populus trichocarpa] ERP57059.1 cellulase family protein [Populus trichocarpa] Length = 496 Score = 72.0 bits (175), Expect = 8e-13 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +2 Query: 122 YPSSYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 + SSYHEY +ALSKSILFFE QRSGYLP DQR++WR +SGL D Sbjct: 23 FQSSYHEYQEALSKSILFFEGQRSGYLPQDQRVTWRANSGLSD 65 >XP_017223002.1 PREDICTED: endoglucanase 6-like [Daucus carota subsp. sativus] Length = 636 Score = 72.0 bits (175), Expect = 8e-13 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +2 Query: 137 HEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGDVEDV 262 H YGDALSKSILFFEAQRSGYLP+ QRI WR HSGL D + V Sbjct: 27 HNYGDALSKSILFFEAQRSGYLPSSQRIKWRGHSGLNDGKSV 68 >OIT19036.1 endoglucanase 24 [Nicotiana attenuata] Length = 147 Score = 68.6 bits (166), Expect = 9e-13 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 131 SYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SYH+Y DAL+KSILFFE QRS YLP DQR++W+ HSGLGD Sbjct: 26 SYHDYTDALTKSILFFEGQRSCYLPQDQRMNWQGHSGLGD 65 >EEF49493.1 endo-1,4-beta-glucanase, putative [Ricinus communis] Length = 432 Score = 71.6 bits (174), Expect = 1e-12 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +2 Query: 128 SSYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SSYHEY +ALSKSILFFE QRSGYLP DQRI+WR +SGL D Sbjct: 21 SSYHEYREALSKSILFFEGQRSGYLPQDQRITWRANSGLSD 61 >XP_015570723.1 PREDICTED: endoglucanase 24 [Ricinus communis] Length = 451 Score = 71.6 bits (174), Expect = 1e-12 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +2 Query: 128 SSYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SSYHEY +ALSKSILFFE QRSGYLP DQRI+WR +SGL D Sbjct: 21 SSYHEYREALSKSILFFEGQRSGYLPQDQRITWRANSGLSD 61 >OMO74401.1 Glycoside hydrolase, family 9 [Corchorus capsularis] Length = 502 Score = 71.6 bits (174), Expect = 1e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +2 Query: 128 SSYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SSYH+Y DALSKSILFFE QRSGYLP DQR++WR +SGL D Sbjct: 31 SSYHDYSDALSKSILFFEGQRSGYLPQDQRMTWRANSGLSD 71 >OMO75530.1 Glycoside hydrolase, family 9 [Corchorus olitorius] Length = 510 Score = 71.6 bits (174), Expect = 1e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +2 Query: 128 SSYHEYGDALSKSILFFEAQRSGYLPTDQRISWRDHSGLGD 250 SSYH+Y DALSKSILFFE QRSGYLP DQR++WR +SGL D Sbjct: 29 SSYHDYSDALSKSILFFEGQRSGYLPQDQRMAWRANSGLSD 69