BLASTX nr result
ID: Lithospermum23_contig00048538
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00048538 (417 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU44553.1 hypothetical protein MIMGU_mgv1a019878mg [Erythranthe... 55 1e-07 XP_006379138.1 hypothetical protein POPTR_0009s08360g, partial [... 53 2e-06 CDP02678.1 unnamed protein product [Coffea canephora] 52 3e-06 GAU24051.1 hypothetical protein TSUD_388440 [Trifolium subterran... 51 4e-06 ACU15290.1 unknown [Glycine max] KRH39516.1 hypothetical protein... 50 8e-06 >EYU44553.1 hypothetical protein MIMGU_mgv1a019878mg [Erythranthe guttata] Length = 69 Score = 55.1 bits (131), Expect = 1e-07 Identities = 22/43 (51%), Positives = 30/43 (69%) Frame = +3 Query: 96 MSDPPKYAYPNPPQGDYKAPLPVVEPPQTVVAPPPAKRKQGWI 224 MS+PPKYAYP P QG Y+ P PV+ PP A PP +++ G++ Sbjct: 1 MSEPPKYAYPYPAQGPYQGPPPVMAPPPQYYAAPPPRKQAGFL 43 >XP_006379138.1 hypothetical protein POPTR_0009s08360g, partial [Populus trichocarpa] ERP56935.1 hypothetical protein POPTR_0009s08360g, partial [Populus trichocarpa] Length = 86 Score = 52.8 bits (125), Expect = 2e-06 Identities = 21/39 (53%), Positives = 27/39 (69%) Frame = +3 Query: 108 PKYAYPNPPQGDYKAPLPVVEPPQTVVAPPPAKRKQGWI 224 PKY YP PPQG Y+ P PV+ PPQ PPP +R+ G++ Sbjct: 22 PKYGYPYPPQGVYQGPPPVMAPPQYYAPPPPPQRQVGFL 60 >CDP02678.1 unnamed protein product [Coffea canephora] Length = 69 Score = 51.6 bits (122), Expect = 3e-06 Identities = 24/44 (54%), Positives = 31/44 (70%), Gaps = 1/44 (2%) Frame = +3 Query: 96 MSDPPKYAYPNPPQGDYKAPLPVVEPPQ-TVVAPPPAKRKQGWI 224 M++PPKYAYP P QG Y+ P PV+ PPQ APPP +R G++ Sbjct: 1 MNEPPKYAYPYPSQGYYQGP-PVMAPPQYQYAAPPPPRRSPGFL 43 >GAU24051.1 hypothetical protein TSUD_388440 [Trifolium subterraneum] Length = 68 Score = 51.2 bits (121), Expect = 4e-06 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = +3 Query: 111 KYAYPNPPQGDYKAPLPVVEPPQTVVAPPPAKRKQGWI 224 KY YP P QG Y+ P PV PPQ APPP KR+ G++ Sbjct: 5 KYGYPYPAQGPYQGPPPVAAPPQYYAAPPPPKREPGFL 42 >ACU15290.1 unknown [Glycine max] KRH39516.1 hypothetical protein GLYMA_09G202700 [Glycine max] Length = 67 Score = 50.4 bits (119), Expect = 8e-06 Identities = 25/43 (58%), Positives = 30/43 (69%) Frame = +3 Query: 96 MSDPPKYAYPNPPQGDYKAPLPVVEPPQTVVAPPPAKRKQGWI 224 MSDP KYAYP P QG Y+ P PV+ PPQ APPP R+ G++ Sbjct: 1 MSDP-KYAYPYPAQGYYQGP-PVMAPPQYYAAPPPRTRQTGFL 41