BLASTX nr result
ID: Lithospermum23_contig00048340
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00048340 (353 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN06523.1 hypothetical protein DCAR_007360 [Daucus carota subsp... 59 6e-08 XP_017232931.1 PREDICTED: protein CHUP1, chloroplastic isoform X... 59 6e-08 XP_017232930.1 PREDICTED: protein CHUP1, chloroplastic isoform X... 59 6e-08 KVI10844.1 hypothetical protein Ccrd_010754 [Cynara cardunculus ... 55 1e-06 XP_002278694.1 PREDICTED: protein CHUP1, chloroplastic [Vitis vi... 55 1e-06 XP_011003883.1 PREDICTED: protein CHUP1, chloroplastic-like [Pop... 55 2e-06 XP_011024930.1 PREDICTED: protein CHUP1, chloroplastic-like [Pop... 54 5e-06 XP_002313983.2 hypothetical protein POPTR_0009s07770g [Populus t... 54 7e-06 EEF40763.1 conserved hypothetical protein [Ricinus communis] 53 9e-06 XP_015576296.1 PREDICTED: protein CHUP1, chloroplastic [Ricinus ... 53 9e-06 >KZN06523.1 hypothetical protein DCAR_007360 [Daucus carota subsp. sativus] Length = 330 Score = 59.3 bits (142), Expect = 6e-08 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 237 RVHHLERENQELRQEVFGLKTQINTLKAHDIERRTTLWK 353 R+H LE ENQEL+QEV LK Q++TLKAHD ER++ LWK Sbjct: 27 RIHSLENENQELKQEVARLKAQVHTLKAHDSERKSVLWK 65 >XP_017232931.1 PREDICTED: protein CHUP1, chloroplastic isoform X2 [Daucus carota subsp. sativus] Length = 407 Score = 59.3 bits (142), Expect = 6e-08 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 237 RVHHLERENQELRQEVFGLKTQINTLKAHDIERRTTLWK 353 R+H LE ENQEL+QEV LK Q++TLKAHD ER++ LWK Sbjct: 27 RIHSLENENQELKQEVARLKAQVHTLKAHDSERKSVLWK 65 >XP_017232930.1 PREDICTED: protein CHUP1, chloroplastic isoform X1 [Daucus carota subsp. sativus] Length = 426 Score = 59.3 bits (142), Expect = 6e-08 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 237 RVHHLERENQELRQEVFGLKTQINTLKAHDIERRTTLWK 353 R+H LE ENQEL+QEV LK Q++TLKAHD ER++ LWK Sbjct: 27 RIHSLENENQELKQEVARLKAQVHTLKAHDSERKSVLWK 65 >KVI10844.1 hypothetical protein Ccrd_010754 [Cynara cardunculus var. scolymus] Length = 427 Score = 55.5 bits (132), Expect = 1e-06 Identities = 22/39 (56%), Positives = 32/39 (82%) Frame = +3 Query: 237 RVHHLERENQELRQEVFGLKTQINTLKAHDIERRTTLWK 353 ++ LE+EN EL+QE+ LK Q+NTLKAHD+ER++ LW+ Sbjct: 23 KIDSLEKENHELKQEMASLKAQVNTLKAHDLERKSVLWR 61 >XP_002278694.1 PREDICTED: protein CHUP1, chloroplastic [Vitis vinifera] Length = 433 Score = 55.5 bits (132), Expect = 1e-06 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = +3 Query: 210 NAERVSFQSRVHHLERENQELRQEVFGLKTQINTLKAHDIERRTTLWK 353 N E S +R + LE+ENQEL+QEV LK QI++LKAHD ER++ LWK Sbjct: 14 NKELESSLARNNALEKENQELKQEVARLKAQISSLKAHDNERKSMLWK 61 >XP_011003883.1 PREDICTED: protein CHUP1, chloroplastic-like [Populus euphratica] Length = 435 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +3 Query: 237 RVHHLERENQELRQEVFGLKTQINTLKAHDIERRTTLWK 353 R +LE+ENQEL+QEV LK QI++LKAHD ER++ LWK Sbjct: 42 RTDYLEKENQELQQEVIRLKAQISSLKAHDNERKSMLWK 80 >XP_011024930.1 PREDICTED: protein CHUP1, chloroplastic-like [Populus euphratica] Length = 439 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 237 RVHHLERENQELRQEVFGLKTQINTLKAHDIERRTTLWK 353 R LE+ENQ+LRQEV LK QI++LKAHD ER++ LWK Sbjct: 41 RTDSLEKENQDLRQEVVRLKAQISSLKAHDNERKSMLWK 79 >XP_002313983.2 hypothetical protein POPTR_0009s07770g [Populus trichocarpa] EEE87938.2 hypothetical protein POPTR_0009s07770g [Populus trichocarpa] Length = 405 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 237 RVHHLERENQELRQEVFGLKTQINTLKAHDIERRTTLWK 353 R LE+ENQEL+QEV LK QI++LKAHD ER++ LWK Sbjct: 42 RTDSLEKENQELQQEVVRLKAQISSLKAHDNERKSMLWK 80 >EEF40763.1 conserved hypothetical protein [Ricinus communis] Length = 326 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 249 LERENQELRQEVFGLKTQINTLKAHDIERRTTLWK 353 LE+ENQELRQEV LK QI++LKAHD ER++ LWK Sbjct: 27 LEKENQELRQEVNRLKAQISSLKAHDNERKSMLWK 61 >XP_015576296.1 PREDICTED: protein CHUP1, chloroplastic [Ricinus communis] Length = 353 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 249 LERENQELRQEVFGLKTQINTLKAHDIERRTTLWK 353 LE+ENQELRQEV LK QI++LKAHD ER++ LWK Sbjct: 27 LEKENQELRQEVNRLKAQISSLKAHDNERKSMLWK 61