BLASTX nr result
ID: Lithospermum23_contig00048276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00048276 (371 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249289.1 PREDICTED: F-box protein At3g07870-like [Daucus c... 55 2e-06 >XP_017249289.1 PREDICTED: F-box protein At3g07870-like [Daucus carota subsp. sativus] Length = 392 Score = 55.1 bits (131), Expect = 2e-06 Identities = 33/91 (36%), Positives = 44/91 (48%), Gaps = 13/91 (14%) Frame = -2 Query: 310 MSTFIPQEMGEQILSKLPIKPLLRFLTVSKEWYKLITTLKLCN----------NHNQLLF 161 MS +IPQE+ +IL KLP++ L+RF V K WY +IT + N N LL Sbjct: 1 MSDYIPQELLHEILIKLPVESLVRFTIVCKSWYSIITDPQFVNLQCNYANLNENKKPLLV 60 Query: 160 GFYS---SENGYIFFIDKDGTFQEYARYEIP 77 FY E Y D + +E+ R E P Sbjct: 61 RFYDRVVKEENYTIRCDDETFSEEFTRVEFP 91