BLASTX nr result
ID: Lithospermum23_contig00048214
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00048214 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016162260.1 PREDICTED: probable inactive leucine-rich repeat ... 52 1e-05 >XP_016162260.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Arachis ipaensis] Length = 754 Score = 52.0 bits (123), Expect = 1e-05 Identities = 26/56 (46%), Positives = 35/56 (62%) Frame = +2 Query: 104 QQASFESGGADQKQLLDPTVLNXXXXXXXXXXXXXTRKCISLESGSRPSFEDILWN 271 ++ASF+S +++++DPTVL T KCIS ES SRPSFED+LWN Sbjct: 685 EKASFDSHDG-RRRIVDPTVLTTCNQESLSIAISITSKCISAESSSRPSFEDVLWN 739