BLASTX nr result
ID: Lithospermum23_contig00047970
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00047970 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011084469.1 PREDICTED: probable membrane-associated kinase re... 57 2e-07 EOY23371.1 Uncharacterized protein TCM_015288 isoform 1 [Theobro... 53 4e-06 XP_007038872.2 PREDICTED: probable membrane-associated kinase re... 52 8e-06 EOY23373.1 Uncharacterized protein TCM_015288 isoform 3 [Theobro... 52 8e-06 >XP_011084469.1 PREDICTED: probable membrane-associated kinase regulator 2 [Sesamum indicum] Length = 324 Score = 56.6 bits (135), Expect = 2e-07 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 9/52 (17%) Frame = -1 Query: 242 DGIQSAILHCKRSYNSNYKEFS---RCSSDSFREKLVN------EEVKRCSI 114 DGIQSAILHCKRSYNS++KEFS R SSD +KL + EE KRCSI Sbjct: 273 DGIQSAILHCKRSYNSSHKEFSQLFRSSSDPSHDKLGHPGRNSCEERKRCSI 324 >EOY23371.1 Uncharacterized protein TCM_015288 isoform 1 [Theobroma cacao] Length = 396 Score = 52.8 bits (125), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 3/42 (7%) Frame = -1 Query: 254 ILHDDGIQSAILHCKRSYNSNYKE---FSRCSSDSFREKLVN 138 +L DGIQSAILHCKRS+NS+ E SRC+SDS +EKL N Sbjct: 318 VLQHDGIQSAILHCKRSFNSSGAESSWLSRCTSDSSQEKLSN 359 >XP_007038872.2 PREDICTED: probable membrane-associated kinase regulator 5 [Theobroma cacao] Length = 395 Score = 52.0 bits (123), Expect = 8e-06 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = -1 Query: 254 ILHDDGIQSAILHCKRSYNSNYKE--FSRCSSDSFREKLVN 138 +L DGIQSAILHCKRS+NS+ + SRC+SDS +EKL N Sbjct: 318 VLQHDGIQSAILHCKRSFNSSGESSWLSRCTSDSSQEKLSN 358 >EOY23373.1 Uncharacterized protein TCM_015288 isoform 3 [Theobroma cacao] Length = 395 Score = 52.0 bits (123), Expect = 8e-06 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = -1 Query: 254 ILHDDGIQSAILHCKRSYNSNYKE--FSRCSSDSFREKLVN 138 +L DGIQSAILHCKRS+NS+ + SRC+SDS +EKL N Sbjct: 318 VLQHDGIQSAILHCKRSFNSSGESSWLSRCTSDSSQEKLSN 358