BLASTX nr result
ID: Lithospermum23_contig00047807
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00047807 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009760448.1 PREDICTED: uncharacterized protein LOC104212793 [... 51 7e-06 >XP_009760448.1 PREDICTED: uncharacterized protein LOC104212793 [Nicotiana sylvestris] Length = 104 Score = 50.8 bits (120), Expect = 7e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 185 PHSFCTFLKPGALAQMRYSKIAAKSRAKYSTTLIAL 78 P SF TFLKPGALAQ+RYSKI+AKSR K + +L A+ Sbjct: 16 PPSFHTFLKPGALAQIRYSKISAKSRLKNAQSLFAI 51