BLASTX nr result
ID: Lithospermum23_contig00047545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00047545 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016902864.1 PREDICTED: pectinesterase-like [Cucumis melo] 55 1e-06 NP_001265901.1 pectinesterase 3-like [Cicer arietinum] CAE76633.... 55 1e-06 XP_012574099.1 PREDICTED: pectinesterase 3-like isoform X1 [Cice... 55 1e-06 OIW17544.1 hypothetical protein TanjilG_22656 [Lupinus angustifo... 55 1e-06 XP_019423588.1 PREDICTED: pectinesterase-like [Lupinus angustifo... 55 1e-06 KDO53765.1 hypothetical protein CISIN_1g018173mg [Citrus sinensis] 55 2e-06 OAY53279.1 hypothetical protein MANES_04G151000 [Manihot esculenta] 55 2e-06 OAY36322.1 hypothetical protein MANES_11G012500 [Manihot esculenta] 55 2e-06 NP_001275859.1 pectinesterase 1 precursor [Citrus sinensis] XP_0... 55 2e-06 P83948.1 RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Fu... 55 2e-06 O04886.1 RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Fu... 55 2e-06 XP_010656074.1 PREDICTED: pectinesterase [Vitis vinifera] 54 2e-06 XP_004141734.1 PREDICTED: pectinesterase-like [Cucumis sativus] ... 54 2e-06 XP_011078160.1 PREDICTED: pectinesterase-like isoform X2 [Sesamu... 54 3e-06 XP_011078159.1 PREDICTED: pectinesterase-like isoform X1 [Sesamu... 54 3e-06 GAV87320.1 Pectinesterase domain-containing protein/PMEI domain-... 54 5e-06 XP_003627458.1 pectinesterase/pectinesterase inhibitor [Medicago... 54 5e-06 EYU29495.1 hypothetical protein MIMGU_mgv1a005211mg [Erythranthe... 53 6e-06 XP_012846852.1 PREDICTED: pectinesterase-like [Erythranthe guttata] 53 6e-06 AFI23411.1 pectin methylesterase [Coffea arabica] 53 6e-06 >XP_016902864.1 PREDICTED: pectinesterase-like [Cucumis melo] Length = 513 Score = 55.5 bits (132), Expect = 1e-06 Identities = 29/53 (54%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSK---NYSPDDVLILLSAAMTN 314 REKIAL DCLET D++LDEL + + L YP+K N DD+ LLS+A+TN Sbjct: 53 REKIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDLKTLLSSAITN 105 >NP_001265901.1 pectinesterase 3-like [Cicer arietinum] CAE76633.2 pectin methylesterase [Cicer arietinum] Length = 584 Score = 55.5 bits (132), Expect = 1e-06 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSKN---YSPDDVLILLSAAMTN 314 REKIAL DCLET DD+LDELK + L YP+K DD+ L+SAA+TN Sbjct: 131 REKIALHDCLETIDDTLDELKEAQRDLVLYPNKKTLYQHADDLKTLISAAITN 183 >XP_012574099.1 PREDICTED: pectinesterase 3-like isoform X1 [Cicer arietinum] Length = 584 Score = 55.5 bits (132), Expect = 1e-06 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSKN---YSPDDVLILLSAAMTN 314 REKIAL DCLET DD+LDELK + L YP+K DD+ L+SAA+TN Sbjct: 131 REKIALHDCLETIDDTLDELKEAQRDLLLYPNKKTLYQHADDLKTLISAAITN 183 >OIW17544.1 hypothetical protein TanjilG_22656 [Lupinus angustifolius] Length = 466 Score = 55.1 bits (131), Expect = 1e-06 Identities = 29/54 (53%), Positives = 39/54 (72%), Gaps = 4/54 (7%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSKNYS----PDDVLILLSAAMTN 314 REK+AL DCLET D+SLDELK+ +L++YP+ S DD+ LLS+A+TN Sbjct: 123 REKVALHDCLETIDESLDELKKAIDELKDYPTSKKSLFQHADDLKTLLSSAITN 176 >XP_019423588.1 PREDICTED: pectinesterase-like [Lupinus angustifolius] Length = 579 Score = 55.1 bits (131), Expect = 1e-06 Identities = 29/54 (53%), Positives = 39/54 (72%), Gaps = 4/54 (7%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSKNYS----PDDVLILLSAAMTN 314 REK+AL DCLET D+SLDELK+ +L++YP+ S DD+ LLS+A+TN Sbjct: 123 REKVALHDCLETIDESLDELKKAIDELKDYPTSKKSLFQHADDLKTLLSSAITN 176 >KDO53765.1 hypothetical protein CISIN_1g018173mg [Citrus sinensis] Length = 360 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSK---NYSPDDVLILLSAAMTN 314 REK+AL DCLET D++LDEL + L+ YP+K + DD+ L+SAAMTN Sbjct: 133 REKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTN 185 >OAY53279.1 hypothetical protein MANES_04G151000 [Manihot esculenta] Length = 581 Score = 54.7 bits (130), Expect = 2e-06 Identities = 29/53 (54%), Positives = 36/53 (67%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSK---NYSPDDVLILLSAAMTN 314 REK AL DCLET D++LDEL + + L+ YPSK DD+ L+SAAMTN Sbjct: 128 REKTALHDCLETIDETLDELHKALVDLKEYPSKKSLTQHADDLKTLMSAAMTN 180 >OAY36322.1 hypothetical protein MANES_11G012500 [Manihot esculenta] Length = 581 Score = 54.7 bits (130), Expect = 2e-06 Identities = 30/53 (56%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSK---NYSPDDVLILLSAAMTN 314 REKIAL DCLET D++LDEL V L+ YPSK + DD+ L+SAA+TN Sbjct: 126 REKIALHDCLETIDETLDELHEVLEDLKEYPSKKSLSQHADDLKTLMSAAITN 178 >NP_001275859.1 pectinesterase 1 precursor [Citrus sinensis] XP_006426800.1 hypothetical protein CICLE_v10025238mg [Citrus clementina] AAB57670.1 pectinesterase [Citrus sinensis] ESR40040.1 hypothetical protein CICLE_v10025238mg [Citrus clementina] Length = 584 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSK---NYSPDDVLILLSAAMTN 314 REK+AL DCLET D++LDEL + L+ YP+K + DD+ L+SAAMTN Sbjct: 133 REKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTN 185 >P83948.1 RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin methylesterase 3; Flags: Precursor Length = 584 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSK---NYSPDDVLILLSAAMTN 314 REK+AL DCLET D++LDEL + L+ YP+K + DD+ L+SAAMTN Sbjct: 133 REKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTN 185 >O04886.1 RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin methylesterase; Flags: Precursor AAB57667.1 pectinesterase [Citrus sinensis] Length = 584 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSK---NYSPDDVLILLSAAMTN 314 REK+AL DCLET D++LDEL + L+ YP+K + DD+ L+SAAMTN Sbjct: 133 REKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTN 185 >XP_010656074.1 PREDICTED: pectinesterase [Vitis vinifera] Length = 578 Score = 54.3 bits (129), Expect = 2e-06 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNY---PSKNYSPDDVLILLSAAMTN 314 REK AL DCLE DD+LDEL + L LQ+Y S + DD++ LLSAAMTN Sbjct: 123 REKAALHDCLEMVDDTLDELHKSALDLQDYSLNKSISQQADDLITLLSAAMTN 175 >XP_004141734.1 PREDICTED: pectinesterase-like [Cucumis sativus] KGN45437.1 hypothetical protein Csa_7G447990 [Cucumis sativus] Length = 595 Score = 54.3 bits (129), Expect = 2e-06 Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSK---NYSPDDVLILLSAAMTN 314 RE+IAL DCLET D++LDEL + + L YP+K N DD+ LLS+A+TN Sbjct: 135 RERIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDLKTLLSSAITN 187 >XP_011078160.1 PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum] Length = 567 Score = 53.9 bits (128), Expect = 3e-06 Identities = 29/54 (53%), Positives = 39/54 (72%), Gaps = 4/54 (7%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSKNYS----PDDVLILLSAAMTN 314 REK AL DCLE DD+LDEL+R +L+++ KNYS ++++ILLSAA TN Sbjct: 116 REKGALHDCLEMIDDTLDELRRSAAELKDFGFKNYSLADHKENLMILLSAAQTN 169 >XP_011078159.1 PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum] Length = 567 Score = 53.9 bits (128), Expect = 3e-06 Identities = 29/54 (53%), Positives = 39/54 (72%), Gaps = 4/54 (7%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSKNYS----PDDVLILLSAAMTN 314 REK AL DCLE DD+LDEL+R +L+++ KNYS ++++ILLSAA TN Sbjct: 116 REKGALHDCLEMIDDTLDELRRSAAELKDFGFKNYSLADHKENLMILLSAAQTN 169 >GAV87320.1 Pectinesterase domain-containing protein/PMEI domain-containing protein, partial [Cephalotus follicularis] Length = 584 Score = 53.5 bits (127), Expect = 5e-06 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSK---NYSPDDVLILLSAAMTN 314 +EK+AL DCLET D++LDEL + LQ YP K DD+ LLSAAMTN Sbjct: 130 QEKVALHDCLETIDETLDELHKAVEDLQQYPHKKSLTEHADDLKTLLSAAMTN 182 >XP_003627458.1 pectinesterase/pectinesterase inhibitor [Medicago truncatula] AET01934.1 pectinesterase/pectinesterase inhibitor [Medicago truncatula] Length = 589 Score = 53.5 bits (127), Expect = 5e-06 Identities = 29/53 (54%), Positives = 36/53 (67%), Gaps = 3/53 (5%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSKN---YSPDDVLILLSAAMTN 314 REKIAL DCLET D++LDELK + L YPSK DD+ L+S+A+TN Sbjct: 132 REKIALHDCLETIDETLDELKEAQNDLVLYPSKKTLYQHADDLKTLISSAITN 184 >EYU29495.1 hypothetical protein MIMGU_mgv1a005211mg [Erythranthe guttata] Length = 493 Score = 53.1 bits (126), Expect = 6e-06 Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 4/54 (7%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSKNYSPDD----VLILLSAAMTN 314 REK AL DCLE DD+LDEL+ E++L++Y KNY+ D ++ LLSAA TN Sbjct: 40 REKGALHDCLEVIDDTLDELRYSEMELKDYGFKNYTLADHKERLMTLLSAAQTN 93 >XP_012846852.1 PREDICTED: pectinesterase-like [Erythranthe guttata] Length = 571 Score = 53.1 bits (126), Expect = 6e-06 Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 4/54 (7%) Frame = +3 Query: 165 REKIALKDCLETADDSLDELKRVELKLQNYPSKNYSPDD----VLILLSAAMTN 314 REK AL DCLE DD+LDEL+ E++L++Y KNY+ D ++ LLSAA TN Sbjct: 118 REKGALHDCLEVIDDTLDELRYSEMELKDYGFKNYTLADHKERLMTLLSAAQTN 171 >AFI23411.1 pectin methylesterase [Coffea arabica] Length = 587 Score = 53.1 bits (126), Expect = 6e-06 Identities = 38/108 (35%), Positives = 46/108 (42%), Gaps = 4/108 (3%) Frame = +3 Query: 3 DLCIXXXXXXXXXXXXNITTVMGVVMAALNHXXXXXXXXXXXXXXXXXXXXXXV-REKIA 179 DLC IT+ V+ LNH REK A Sbjct: 83 DLCFSTLANLPQAVSQKITSQKDVIELVLNHTTTTVEHNYFAVEHLIATHHNLTEREKTA 142 Query: 180 LKDCLETADDSLDELKRVELKLQNYPSK---NYSPDDVLILLSAAMTN 314 L DCLET D++LDEL + L+ YPSK DD+ L+SAAMTN Sbjct: 143 LHDCLETIDETLDELHQTVKDLELYPSKKSLKQHADDLKTLMSAAMTN 190