BLASTX nr result
ID: Lithospermum23_contig00047280
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00047280 (309 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006379274.1 PROLINE-RICH protein 4 [Populus trichocarpa] ERP5... 53 5e-06 XP_011046767.1 PREDICTED: proline-rich protein 4 [Populus euphra... 53 5e-06 XP_006379275.1 hypothetical protein POPTR_0009s13250g [Populus t... 53 5e-06 XP_006379276.1 hypothetical protein POPTR_0009s13250g [Populus t... 53 5e-06 >XP_006379274.1 PROLINE-RICH protein 4 [Populus trichocarpa] ERP57071.1 PROLINE-RICH protein 4 [Populus trichocarpa] Length = 302 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/46 (56%), Positives = 30/46 (65%) Frame = +3 Query: 165 MSFFPIFRGALLSFLAVLAVIATTQCHADEQMIEVVGIGECADCKE 302 M P+FRGALL F L V A C+AD+ EVVGIGECADC + Sbjct: 1 MRILPVFRGALLCFYVSL-VFAAAFCYADDSTAEVVGIGECADCAQ 45 >XP_011046767.1 PREDICTED: proline-rich protein 4 [Populus euphratica] Length = 312 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/46 (54%), Positives = 30/46 (65%) Frame = +3 Query: 165 MSFFPIFRGALLSFLAVLAVIATTQCHADEQMIEVVGIGECADCKE 302 M P+FRGALL F L V C+AD+ +EVVGIGECADC + Sbjct: 1 MRILPVFRGALLCFYVSL-VFGAAFCYADDSTVEVVGIGECADCAQ 45 >XP_006379275.1 hypothetical protein POPTR_0009s13250g [Populus trichocarpa] ERP57072.1 hypothetical protein POPTR_0009s13250g [Populus trichocarpa] Length = 328 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/46 (56%), Positives = 30/46 (65%) Frame = +3 Query: 165 MSFFPIFRGALLSFLAVLAVIATTQCHADEQMIEVVGIGECADCKE 302 M P+FRGALL F L V A C+AD+ EVVGIGECADC + Sbjct: 1 MRILPVFRGALLCFYVSL-VFAAAFCYADDSTAEVVGIGECADCAQ 45 >XP_006379276.1 hypothetical protein POPTR_0009s13250g [Populus trichocarpa] ERP57073.1 hypothetical protein POPTR_0009s13250g [Populus trichocarpa] Length = 336 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/46 (56%), Positives = 30/46 (65%) Frame = +3 Query: 165 MSFFPIFRGALLSFLAVLAVIATTQCHADEQMIEVVGIGECADCKE 302 M P+FRGALL F L V A C+AD+ EVVGIGECADC + Sbjct: 1 MRILPVFRGALLCFYVSL-VFAAAFCYADDSTAEVVGIGECADCAQ 45