BLASTX nr result
ID: Lithospermum23_contig00047234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00047234 (283 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP76107.1 Putative ribonuclease H protein At1g65750 [Cajanus ca... 53 4e-06 GAU42618.1 hypothetical protein TSUD_238110 [Trifolium subterran... 53 6e-06 >KYP76107.1 Putative ribonuclease H protein At1g65750 [Cajanus cajan] Length = 682 Score = 53.1 bits (126), Expect = 4e-06 Identities = 21/59 (35%), Positives = 34/59 (57%) Frame = -1 Query: 247 PSSSSQPIGLWENM*EWKIPSKIKHHVWRIYTDSLPSATNLRKRGIVVMEWCPLCGEGL 71 P+++ P W + IP+K+KHH WR+Y + LP+ L+K+G+ CP C G+ Sbjct: 351 PTNTMDPDKTWNIIWSLPIPAKVKHHTWRVYKNILPTRAQLQKKGVSCPISCPRCDVGI 409 >GAU42618.1 hypothetical protein TSUD_238110 [Trifolium subterraneum] Length = 588 Score = 52.8 bits (125), Expect = 6e-06 Identities = 22/48 (45%), Positives = 29/48 (60%) Frame = -1 Query: 220 LWENM*EWKIPSKIKHHVWRIYTDSLPSATNLRKRGIVVMEWCPLCGE 77 +W+ + + KIP K H +WRI DSLP NLRKRG+ CP C + Sbjct: 328 VWQKLWQLKIPPKYTHLIWRILQDSLPVQKNLRKRGVNCYSLCPRCND 375