BLASTX nr result
ID: Lithospermum23_contig00047233
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00047233 (392 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP10741.1 unnamed protein product [Coffea canephora] 55 2e-06 >CDP10741.1 unnamed protein product [Coffea canephora] Length = 229 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -3 Query: 390 SMVLPAQEYNPIHDYLTRNMLQLNMMEGGSSYQIPEEKSVQL 265 S+V P QEYN + YL RN+LQLNMMEG +Q+P++KS+QL Sbjct: 182 SIVPPGQEYNEMQAYLARNLLQLNMMEGLPVFQVPDKKSLQL 223