BLASTX nr result
ID: Lithospermum23_contig00047133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00047133 (633 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONI31263.1 hypothetical protein PRUPE_1G302400 [Prunus persica] 60 9e-09 JAT55872.1 SWI/SNF-related matrix-associated actin-dependent reg... 57 4e-07 OMP02253.1 hypothetical protein COLO4_11238 [Corchorus olitorius] 55 7e-07 EOY02186.1 Uncharacterized protein TCM_011894 [Theobroma cacao] 54 1e-06 >ONI31263.1 hypothetical protein PRUPE_1G302400 [Prunus persica] Length = 64 Score = 59.7 bits (143), Expect = 9e-09 Identities = 33/63 (52%), Positives = 39/63 (61%), Gaps = 12/63 (19%) Frame = -2 Query: 383 MTSVKVEKPIGSQ-----TKKEPSVKT-------PSSKQGPKKTELKPRDPKKKRTAKSP 240 M S+KVEKP+G+Q KKEP+ K P+SK PKK E KPR+PKKK T P Sbjct: 1 MASLKVEKPVGTQPSAGQAKKEPAPKASSTTPRAPASKPAPKKAEPKPREPKKKTTGSKP 60 Query: 239 AAK 231 AAK Sbjct: 61 AAK 63 >JAT55872.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 [Anthurium amnicola] Length = 123 Score = 57.0 bits (136), Expect = 4e-07 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 12/67 (17%) Frame = -2 Query: 395 KANKMTSVKVEKPIGSQT------KKEPS------VKTPSSKQGPKKTELKPRDPKKKRT 252 + +M S+KVE+P+GSQ KKEPS K +S+ GPKK E KPR+PKKK Sbjct: 56 QTERMASLKVERPVGSQPASSGQPKKEPSKASEGPAKATASRPGPKKAEQKPREPKKKAK 115 Query: 251 AKSPAAK 231 + PAA+ Sbjct: 116 SGKPAAR 122 >OMP02253.1 hypothetical protein COLO4_11238 [Corchorus olitorius] Length = 64 Score = 54.7 bits (130), Expect = 7e-07 Identities = 34/62 (54%), Positives = 38/62 (61%), Gaps = 11/62 (17%) Frame = -2 Query: 383 MTSVKVEKPIGSQTKKEPSVKT---------PSSKQGPKKTELKPRDPKKKRT--AKSPA 237 M S+KVEKPI + K S KT P+SK PKKTE KPRDPKKK + AKS A Sbjct: 1 MASLKVEKPITEKEKAVGSAKTKPSSSAPKAPASKPAPKKTEQKPRDPKKKASGAAKSSA 60 Query: 236 AK 231 AK Sbjct: 61 AK 62 >EOY02186.1 Uncharacterized protein TCM_011894 [Theobroma cacao] Length = 66 Score = 54.3 bits (129), Expect = 1e-06 Identities = 31/63 (49%), Positives = 37/63 (58%), Gaps = 12/63 (19%) Frame = -2 Query: 383 MTSVKVEKPIGS------QTKKEP------SVKTPSSKQGPKKTELKPRDPKKKRTAKSP 240 M S+K EKP+G+ Q KKEP + K P SK PKKTE KPR+PKKK + Sbjct: 1 MASLKAEKPVGTPSSGSGQAKKEPIKPSGSAPKAPISKPAPKKTEQKPREPKKKASGAKS 60 Query: 239 AAK 231 AAK Sbjct: 61 AAK 63