BLASTX nr result
ID: Lithospermum23_contig00047041
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00047041 (475 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK56216.1 uncharacterized protein A4U43_C10F5320 [Asparagus off... 56 3e-06 >ONK56216.1 uncharacterized protein A4U43_C10F5320 [Asparagus officinalis] Length = 306 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -1 Query: 400 QESCKRTRYACWSTVENKFLLTGYFLVSNDSELGTNQKSVTF*KKL 263 Q+S K+ YA W+ ENK LLTGYF S DSELG+NQK TF K+ Sbjct: 107 QQSAKKGNYASWTFEENKLLLTGYFHYSTDSELGSNQKGDTFWGKI 152