BLASTX nr result
ID: Lithospermum23_contig00046562
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00046562 (268 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010100669.1 3-ketoacyl-CoA synthase 1 [Morus notabilis] EXB83... 61 7e-09 XP_011025387.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Populus eup... 58 6e-08 XP_002301436.2 fatty acid elongase 3-ketoacyl-CoA synthase 1 fam... 58 6e-08 KZV30228.1 3-ketoacyl-CoA synthase 1, partial [Dorcoceras hygrom... 58 9e-08 XP_011100666.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Sesamum ind... 58 9e-08 KVH84539.1 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C... 57 2e-07 AAC34858.1 senescence-associated protein 15 [Hemerocallis hybrid... 54 2e-06 XP_015089314.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Solanum pen... 54 2e-06 XP_004248096.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Solanum lyc... 54 2e-06 XP_016472398.1 PREDICTED: 3-ketoacyl-CoA synthase 1-like [Nicoti... 54 2e-06 XP_009758872.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Nicotiana s... 54 2e-06 XP_009606335.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Nicotiana t... 54 2e-06 XP_006361008.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Solanum tub... 54 3e-06 ONK72656.1 uncharacterized protein A4U43_C04F21660 [Asparagus of... 53 4e-06 XP_019265867.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Nicotiana a... 53 4e-06 XP_019419244.1 PREDICTED: 3-ketoacyl-CoA synthase 1-like [Lupinu... 53 4e-06 EYU32293.1 hypothetical protein MIMGU_mgv1a004078mg [Erythranthe... 53 4e-06 XP_012843902.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Erythranthe... 53 4e-06 XP_010523834.1 PREDICTED: 3-ketoacyl-CoA synthase 13 [Tarenaya h... 53 5e-06 XP_016545479.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Capsicum an... 53 5e-06 >XP_010100669.1 3-ketoacyl-CoA synthase 1 [Morus notabilis] EXB83831.1 3-ketoacyl-CoA synthase 1 [Morus notabilis] Length = 534 Score = 60.8 bits (146), Expect = 7e-09 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCLGNPWNDCVDYYPVKM 105 KCNSAVWKAL+E+P + LGNPWNDC+D YPVK+ Sbjct: 498 KCNSAVWKALREVPVGEF-LGNPWNDCIDRYPVKV 531 >XP_011025387.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Populus euphratica] Length = 522 Score = 58.2 bits (139), Expect = 6e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCLGNPWNDCVDYYPVKM 105 KCNSAVWKAL+EIPA + GNPWND +D+YPVK+ Sbjct: 486 KCNSAVWKALREIPAGE-SKGNPWNDSIDWYPVKV 519 >XP_002301436.2 fatty acid elongase 3-ketoacyl-CoA synthase 1 family protein [Populus trichocarpa] EEE80709.2 fatty acid elongase 3-ketoacyl-CoA synthase 1 family protein [Populus trichocarpa] Length = 527 Score = 58.2 bits (139), Expect = 6e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCLGNPWNDCVDYYPVKM 105 KCNSAVWKAL+EIPA + GNPWND +D+YPVK+ Sbjct: 491 KCNSAVWKALREIPAGE-SKGNPWNDSIDWYPVKV 524 >KZV30228.1 3-ketoacyl-CoA synthase 1, partial [Dorcoceras hygrometricum] Length = 495 Score = 57.8 bits (138), Expect = 9e-08 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCLGNPWNDCVDYYPVKM 105 KCNSAVW+AL+EIPA + C NPW DC+D YPVK+ Sbjct: 458 KCNSAVWRALREIPAQE-CKANPWCDCIDNYPVKI 491 >XP_011100666.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Sesamum indicum] Length = 546 Score = 57.8 bits (138), Expect = 9e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCLGNPWNDCVDYYPVKM 105 KCNSAVWKAL++IPA K C G+PW DC+D YPV++ Sbjct: 509 KCNSAVWKALRDIPA-KECRGSPWYDCIDKYPVEV 542 >KVH84539.1 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal [Cynara cardunculus var. scolymus] Length = 526 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCLGNPWNDCVDYYPVKMCLA 114 KCNSAVW+ALK IP C GNPW DC+D YPVK+ +A Sbjct: 491 KCNSAVWRALKTIPGG--CEGNPWADCIDRYPVKVPVA 526 >AAC34858.1 senescence-associated protein 15 [Hemerocallis hybrid cultivar] Length = 517 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/40 (60%), Positives = 29/40 (72%), Gaps = 6/40 (15%) Frame = +1 Query: 1 KCNSAVWKALKEIPA-DKVCLG-----NPWNDCVDYYPVK 102 KCNSAVWKA+K++PA D+ G NPW DC+D YPVK Sbjct: 478 KCNSAVWKAMKDVPAIDRTASGSSRMCNPWGDCIDRYPVK 517 >XP_015089314.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Solanum pennellii] Length = 529 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKV-CLGNPWNDCVDYYPVKMCLA 114 KCNSAVWK+L+ I D+V GNPW DC+ YPVK+ LA Sbjct: 489 KCNSAVWKSLRVIDCDEVNANGNPWADCIQRYPVKVALA 527 >XP_004248096.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Solanum lycopersicum] Length = 529 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKV-CLGNPWNDCVDYYPVKMCLA 114 KCNSAVWK+L+ I D+V GNPW DC+ YPVK+ LA Sbjct: 489 KCNSAVWKSLRVIDCDEVNANGNPWADCIQRYPVKVALA 527 >XP_016472398.1 PREDICTED: 3-ketoacyl-CoA synthase 1-like [Nicotiana tabacum] Length = 532 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/39 (61%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCL-GNPWNDCVDYYPVKMCLA 114 KCNSAVWK+L+EI ++V GNPW DC+ YPVK+ LA Sbjct: 492 KCNSAVWKSLREIDCNEVNRNGNPWADCIQRYPVKVALA 530 >XP_009758872.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Nicotiana sylvestris] XP_016499368.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Nicotiana tabacum] Length = 532 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/39 (61%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCL-GNPWNDCVDYYPVKMCLA 114 KCNSAVWK+L+EI ++V GNPW DC+ YPVK+ LA Sbjct: 492 KCNSAVWKSLREIDCNEVNRNGNPWADCIQRYPVKVALA 530 >XP_009606335.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Nicotiana tomentosiformis] Length = 532 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/39 (61%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCL-GNPWNDCVDYYPVKMCLA 114 KCNSAVWK+L+EI ++V GNPW DC+ YPVK+ LA Sbjct: 492 KCNSAVWKSLREIDCNEVNRNGNPWADCIQRYPVKVALA 530 >XP_006361008.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Solanum tuberosum] Length = 535 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/39 (61%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKV-CLGNPWNDCVDYYPVKMCLA 114 KCNSAVWK+LK I +++V GNPW DC+ YPVK+ LA Sbjct: 495 KCNSAVWKSLKVIDSNEVNANGNPWADCIQRYPVKVALA 533 >ONK72656.1 uncharacterized protein A4U43_C04F21660 [Asparagus officinalis] Length = 242 Score = 52.8 bits (125), Expect = 4e-06 Identities = 23/39 (58%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKV---CLGNPWNDCVDYYPVKMC 108 KCNSAVW+AL+++PA V C NPW DC+D YPV C Sbjct: 205 KCNSAVWRALRDVPATVVNGKC--NPWGDCIDRYPVPSC 241 >XP_019265867.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Nicotiana attenuata] OIT35418.1 3-ketoacyl-coa synthase 1 [Nicotiana attenuata] Length = 532 Score = 53.1 bits (126), Expect = 4e-06 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCL-GNPWNDCVDYYPVKMCLA 114 KCNSAVWK+L+EI + V GNPW DC+ YPVK+ LA Sbjct: 492 KCNSAVWKSLREIDCNDVNRNGNPWADCIQRYPVKVALA 530 >XP_019419244.1 PREDICTED: 3-ketoacyl-CoA synthase 1-like [Lupinus angustifolius] OIV95064.1 hypothetical protein TanjilG_10884 [Lupinus angustifolius] Length = 538 Score = 53.1 bits (126), Expect = 4e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCLGNPWNDCVDYYPV 99 KCNSAVWKA+K +PA K GNPW+D VD YPV Sbjct: 496 KCNSAVWKAVKAMPAVKDWRGNPWDDSVDKYPV 528 >EYU32293.1 hypothetical protein MIMGU_mgv1a004078mg [Erythranthe guttata] Length = 545 Score = 53.1 bits (126), Expect = 4e-06 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCLGNPWNDCVDYYPV 99 KCNSAVWKAL++IPA NPW DC+D YPV Sbjct: 503 KCNSAVWKALRDIPAKDCPSTNPWFDCIDNYPV 535 >XP_012843902.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Erythranthe guttata] Length = 558 Score = 53.1 bits (126), Expect = 4e-06 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCLGNPWNDCVDYYPV 99 KCNSAVWKAL++IPA NPW DC+D YPV Sbjct: 516 KCNSAVWKALRDIPAKDCPSTNPWFDCIDNYPV 548 >XP_010523834.1 PREDICTED: 3-ketoacyl-CoA synthase 13 [Tarenaya hassleriana] Length = 462 Score = 52.8 bits (125), Expect = 5e-06 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKVCLGNPWNDCVDYYPVKM 105 KCNS VW+AL+ IPAD+ LGNPW D V YPV++ Sbjct: 427 KCNSIVWRALRTIPADESSLGNPWVDSVHKYPVQV 461 >XP_016545479.1 PREDICTED: 3-ketoacyl-CoA synthase 1 [Capsicum annuum] Length = 533 Score = 52.8 bits (125), Expect = 5e-06 Identities = 23/39 (58%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +1 Query: 1 KCNSAVWKALKEIPADKV-CLGNPWNDCVDYYPVKMCLA 114 KCNSAVWK+L+ I +++V GNPW DC+ YPVK+ LA Sbjct: 493 KCNSAVWKSLRAIDSNEVNANGNPWADCIQRYPVKVALA 531