BLASTX nr result
ID: Lithospermum23_contig00046395
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00046395 (392 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011030995.1 PREDICTED: inactive TPR repeat-containing thiored... 60 5e-08 XP_002306314.2 hypothetical protein POPTR_0005s07850g [Populus t... 60 7e-08 CDP01439.1 unnamed protein product [Coffea canephora] 60 8e-08 XP_002309983.2 hypothetical protein POPTR_0007s05640g, partial [... 55 2e-06 XP_011022777.1 PREDICTED: inactive TPR repeat-containing thiored... 55 2e-06 XP_016459246.1 PREDICTED: inactive TPR repeat-containing thiored... 55 2e-06 XP_009621849.1 PREDICTED: inactive TPR repeat-containing thiored... 55 2e-06 XP_012845008.1 PREDICTED: TPR repeat-containing thioredoxin TTL4... 55 3e-06 EYU31019.1 hypothetical protein MIMGU_mgv1a024042mg [Erythranthe... 55 3e-06 >XP_011030995.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Populus euphratica] Length = 606 Score = 60.1 bits (144), Expect = 5e-08 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = -1 Query: 152 MEDETPERRSTGCGLFGTIFRGKNTWPRRSTSTGSIPHTNPNNLPRHTST 3 M D +PE++ GCGLF +F ++ WPRRSTSTGSIP N N R ST Sbjct: 1 MGDMSPEKKPAGCGLFSVVFGRRSFWPRRSTSTGSIPTVNAANFTRTPST 50 >XP_002306314.2 hypothetical protein POPTR_0005s07850g [Populus trichocarpa] EEE93310.2 hypothetical protein POPTR_0005s07850g [Populus trichocarpa] Length = 570 Score = 59.7 bits (143), Expect = 7e-08 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = -1 Query: 152 MEDETPERRSTGCGLFGTIFRGKNTWPRRSTSTGSIPHTNPNNLPRHTST 3 M D +PE++ GCGLF +F ++ WPRRSTSTGSIP N N R ST Sbjct: 1 MGDISPEKKPAGCGLFSVVFGRRSFWPRRSTSTGSIPTVNAANFTRTPST 50 >CDP01439.1 unnamed protein product [Coffea canephora] Length = 702 Score = 59.7 bits (143), Expect = 8e-08 Identities = 27/52 (51%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = -1 Query: 152 MEDETPERRSTGCGLFGTIFRGKNTWPRRSTSTGSI--PHTNPNNLPRHTST 3 M D +PE++ +GCGL +F G+ +WPRR+TSTGS+ P++NPN+ PR ST Sbjct: 1 MGDVSPEQKKSGCGLLNAVF-GRRSWPRRTTSTGSLPGPNSNPNHFPRIPST 51 >XP_002309983.2 hypothetical protein POPTR_0007s05640g, partial [Populus trichocarpa] EEE90433.2 hypothetical protein POPTR_0007s05640g, partial [Populus trichocarpa] Length = 573 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/50 (52%), Positives = 32/50 (64%) Frame = -1 Query: 152 MEDETPERRSTGCGLFGTIFRGKNTWPRRSTSTGSIPHTNPNNLPRHTST 3 M D +PE++S GCGLF +F + WPRRSTSTGSI N N + ST Sbjct: 1 MGDLSPEKKSAGCGLFSAVFGQRVFWPRRSTSTGSISTMNAANFTKTPST 50 >XP_011022777.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Populus euphratica] Length = 606 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/50 (52%), Positives = 32/50 (64%) Frame = -1 Query: 152 MEDETPERRSTGCGLFGTIFRGKNTWPRRSTSTGSIPHTNPNNLPRHTST 3 M D +PE++S GCGLF +F + WPRRSTSTGSI N N + ST Sbjct: 1 MGDLSPEKKSAGCGLFSAVFGRRVFWPRRSTSTGSISTMNAANFTKTPST 50 >XP_016459246.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana tabacum] Length = 640 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = -1 Query: 164 IISDMEDETPERRSTGCGLFGTIFRGKNTWPRRSTSTGSIP---HTNPNNLPRHTST 3 I S+M D +PE++ TGCGL +F +N W RRSTSTGS+P N NN+ R +ST Sbjct: 28 ITSNMGDISPEKK-TGCGLLNAVFGRRNIWTRRSTSTGSLPTQDTNNVNNVTRSSST 83 >XP_009621849.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana tomentosiformis] Length = 640 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = -1 Query: 164 IISDMEDETPERRSTGCGLFGTIFRGKNTWPRRSTSTGSIP---HTNPNNLPRHTST 3 I S+M D +PE++ TGCGL +F +N W RRSTSTGS+P N NN+ R +ST Sbjct: 28 ITSNMGDISPEKK-TGCGLLNAVFGRRNIWTRRSTSTGSLPTQDTNNVNNVTRSSST 83 >XP_012845008.1 PREDICTED: TPR repeat-containing thioredoxin TTL4-like [Erythranthe guttata] Length = 451 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/51 (50%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -1 Query: 152 MEDETPERRSTGCGLFGTIFRGKNTWPRRSTSTGSIP-HTNPNNLPRHTST 3 M D + ++RS GCG+F +F ++ WPRRSTSTGS+P +NPN++ R+ ST Sbjct: 1 MGDVSHDKRS-GCGIFNVVFGRRSIWPRRSTSTGSLPSSSNPNHVTRYPST 50 >EYU31019.1 hypothetical protein MIMGU_mgv1a024042mg [Erythranthe guttata] Length = 699 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/51 (50%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -1 Query: 152 MEDETPERRSTGCGLFGTIFRGKNTWPRRSTSTGSIP-HTNPNNLPRHTST 3 M D + ++RS GCG+F +F ++ WPRRSTSTGS+P +NPN++ R+ ST Sbjct: 1 MGDVSHDKRS-GCGIFNVVFGRRSIWPRRSTSTGSLPSSSNPNHVTRYPST 50