BLASTX nr result
ID: Lithospermum23_contig00046306
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00046306 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019242292.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 1e-08 OIT36779.1 pentatricopeptide repeat-containing protein, chloropl... 60 1e-08 XP_016493694.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 1e-08 XP_009793197.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 1e-08 XP_011071290.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 7e-08 >XP_019242292.1 PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Nicotiana attenuata] Length = 415 Score = 60.5 bits (145), Expect = 1e-08 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +3 Query: 183 VKSGCLSSAIHLFDEMPHKDVITWNIMISGNNFYGFQQK 299 VK G L+SA+HLF+EMP +DV+TWNIMISG + YGF +K Sbjct: 55 VKYGSLTSALHLFEEMPKRDVVTWNIMISGYSHYGFPRK 93 >OIT36779.1 pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 665 Score = 60.5 bits (145), Expect = 1e-08 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +3 Query: 183 VKSGCLSSAIHLFDEMPHKDVITWNIMISGNNFYGFQQK 299 VK G L+SA+HLF+EMP +DV+TWNIMISG + YGF +K Sbjct: 55 VKYGSLTSALHLFEEMPKRDVVTWNIMISGYSHYGFPRK 93 >XP_016493694.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Nicotiana tabacum] Length = 678 Score = 60.5 bits (145), Expect = 1e-08 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +3 Query: 183 VKSGCLSSAIHLFDEMPHKDVITWNIMISGNNFYGFQQK 299 VK G L+SA+HLF+EMP +DV+TWNIMISG + YGF +K Sbjct: 68 VKYGSLTSALHLFEEMPKRDVVTWNIMISGYSHYGFPRK 106 >XP_009793197.1 PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like [Nicotiana sylvestris] Length = 1107 Score = 60.5 bits (145), Expect = 1e-08 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +3 Query: 183 VKSGCLSSAIHLFDEMPHKDVITWNIMISGNNFYGFQQK 299 VK G L+SA+HLF+EMP +DV+TWNIMISG + YGF +K Sbjct: 55 VKYGSLTSALHLFEEMPKRDVVTWNIMISGYSHYGFPRK 93 >XP_011071290.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Sesamum indicum] Length = 675 Score = 58.5 bits (140), Expect = 7e-08 Identities = 37/93 (39%), Positives = 50/93 (53%), Gaps = 1/93 (1%) Frame = +3 Query: 15 MKSRRLPPFATKIITILTAKHKPLQNPKSNPRIILLHNSKE-HXXXXXXXXXXXXXXVKS 191 M+++ L + IT KHKPL + R+ L ++K +KS Sbjct: 1 MRNQNLVLSFARAITF-ALKHKPLLLSNFSLRVHTLCDNKHIDHANIYSYNRAIDNLLKS 59 Query: 192 GCLSSAIHLFDEMPHKDVITWNIMISGNNFYGF 290 G L SA++LFD+MP +DVITWNIMISG YGF Sbjct: 60 GSLGSALNLFDQMPERDVITWNIMISGYYHYGF 92