BLASTX nr result
ID: Lithospermum23_contig00046223
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00046223 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP07450.1 unnamed protein product [Coffea canephora] 57 3e-07 >CDP07450.1 unnamed protein product [Coffea canephora] Length = 364 Score = 56.6 bits (135), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%), Gaps = 4/63 (6%) Frame = +1 Query: 4 HHH----QEPLNLIXXXXXXXXXXXXXXXMGANLGISMLDPSVYPTPLSAFMVGSPFFQP 171 HHH Q PLNLI N ++MLDPS+YPTPLSAFM G+ FF P Sbjct: 305 HHHDHDPQPPLNLIGAAAAATANAAVT---STNPALTMLDPSIYPTPLSAFMAGTQFFPP 361 Query: 172 PRS 180 PRS Sbjct: 362 PRS 364