BLASTX nr result
ID: Lithospermum23_contig00046018
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00046018 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011099549.1 PREDICTED: elongator complex protein 5 [Sesamum i... 84 1e-16 KZV53877.1 elongator complex protein 5 [Dorcoceras hygrometricum] 80 3e-15 XP_004145651.1 PREDICTED: elongator complex protein 5 isoform X2... 79 7e-15 XP_011651354.1 PREDICTED: elongator complex protein 5 isoform X1... 79 7e-15 XP_012854704.1 PREDICTED: elongator complex protein 5 [Erythrant... 78 9e-15 XP_018816992.1 PREDICTED: elongator complex protein 5 isoform X2... 76 2e-14 XP_018816989.1 PREDICTED: elongator complex protein 5 isoform X1... 76 4e-14 XP_017215965.1 PREDICTED: elongator complex protein 5 [Daucus ca... 76 7e-14 XP_015881341.1 PREDICTED: elongator complex protein 5-like isofo... 74 2e-13 XP_015881340.1 PREDICTED: elongator complex protein 5-like isofo... 74 2e-13 XP_009798036.1 PREDICTED: elongator complex protein 5 isoform X2... 74 3e-13 XP_009798035.1 PREDICTED: elongator complex protein 5 isoform X1... 74 3e-13 XP_010693201.1 PREDICTED: elongator complex protein 5 [Beta vulg... 74 4e-13 GAV89541.1 Hap2_elong domain-containing protein [Cephalotus foll... 74 4e-13 XP_019262098.1 PREDICTED: elongator complex protein 5 [Nicotiana... 74 5e-13 KNA25865.1 hypothetical protein SOVF_001720 [Spinacia oleracea] 73 6e-13 XP_006653258.1 PREDICTED: elongator complex protein 5-like [Oryz... 73 6e-13 XP_016510723.1 PREDICTED: elongator complex protein 5-like isofo... 72 1e-12 ONK76988.1 uncharacterized protein A4U43_C02F1960 [Asparagus off... 72 1e-12 XP_009625000.1 PREDICTED: elongator complex protein 5 isoform X1... 72 1e-12 >XP_011099549.1 PREDICTED: elongator complex protein 5 [Sesamum indicum] Length = 372 Score = 83.6 bits (205), Expect = 1e-16 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 ELSVE+S I+F L+SE+E AQ+LVPKVQFNL L+EKERNDR KVVLPFEHQG Sbjct: 260 ELSVEKSGIKFTPLSSEDEMTAQSLVPKVQFNLQLSEKERNDRAKVVLPFEHQG 313 >KZV53877.1 elongator complex protein 5 [Dorcoceras hygrometricum] Length = 375 Score = 79.7 bits (195), Expect = 3e-15 Identities = 37/54 (68%), Positives = 47/54 (87%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 EL +E+S I+F S++ E++ I+QN+VPKVQFNL L+EKERNDR KVVLPFEHQG Sbjct: 260 ELRIEKSGIKFSSVSYEDDLISQNIVPKVQFNLQLSEKERNDRAKVVLPFEHQG 313 >XP_004145651.1 PREDICTED: elongator complex protein 5 isoform X2 [Cucumis sativus] KGN57713.1 hypothetical protein Csa_3G258150 [Cucumis sativus] Length = 375 Score = 78.6 bits (192), Expect = 7e-15 Identities = 36/54 (66%), Positives = 46/54 (85%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 + +VEQS I+F S++SE+ I Q+L+PKVQFNL L+EKERNDR +VVLPFEHQG Sbjct: 259 DFNVEQSGIKFTSISSEDAVINQSLIPKVQFNLQLSEKERNDRARVVLPFEHQG 312 >XP_011651354.1 PREDICTED: elongator complex protein 5 isoform X1 [Cucumis sativus] Length = 376 Score = 78.6 bits (192), Expect = 7e-15 Identities = 36/54 (66%), Positives = 46/54 (85%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 + +VEQS I+F S++SE+ I Q+L+PKVQFNL L+EKERNDR +VVLPFEHQG Sbjct: 260 DFNVEQSGIKFTSISSEDAVINQSLIPKVQFNLQLSEKERNDRARVVLPFEHQG 313 >XP_012854704.1 PREDICTED: elongator complex protein 5 [Erythranthe guttata] EYU44627.1 hypothetical protein MIMGU_mgv1a008766mg [Erythranthe guttata] Length = 363 Score = 78.2 bits (191), Expect = 9e-15 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 E VE+S I+F ++SE E IAQ+LVPKVQFNL L+EKER+DR KVVLPFEHQG Sbjct: 256 EFHVEKSGIKFAPVSSENEIIAQSLVPKVQFNLQLSEKERDDRAKVVLPFEHQG 309 >XP_018816992.1 PREDICTED: elongator complex protein 5 isoform X2 [Juglans regia] Length = 241 Score = 75.9 bits (185), Expect = 2e-14 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 E VEQS I F SL+S +E I ++L+PKVQFNL L+EKE+NDR KVVLPFEHQG Sbjct: 125 EFDVEQSVINFTSLSSGDELINRSLLPKVQFNLQLSEKEQNDRAKVVLPFEHQG 178 >XP_018816989.1 PREDICTED: elongator complex protein 5 isoform X1 [Juglans regia] XP_018816990.1 PREDICTED: elongator complex protein 5 isoform X1 [Juglans regia] XP_018816991.1 PREDICTED: elongator complex protein 5 isoform X1 [Juglans regia] Length = 306 Score = 75.9 bits (185), Expect = 4e-14 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 E VEQS I F SL+S +E I ++L+PKVQFNL L+EKE+NDR KVVLPFEHQG Sbjct: 190 EFDVEQSVINFTSLSSGDELINRSLLPKVQFNLQLSEKEQNDRAKVVLPFEHQG 243 >XP_017215965.1 PREDICTED: elongator complex protein 5 [Daucus carota subsp. sativus] Length = 376 Score = 75.9 bits (185), Expect = 7e-14 Identities = 37/54 (68%), Positives = 47/54 (87%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 E SV+QS I+F S +SE+ A+AQ++VPK+QFNL L+EKE+NDR KVVLPFEHQG Sbjct: 261 EFSVDQSGIKFKSFSSED-AVAQSIVPKLQFNLQLSEKEKNDRAKVVLPFEHQG 313 >XP_015881341.1 PREDICTED: elongator complex protein 5-like isoform X2 [Ziziphus jujuba] XP_015867535.1 PREDICTED: elongator complex protein 5-like isoform X2 [Ziziphus jujuba] Length = 357 Score = 74.3 bits (181), Expect = 2e-13 Identities = 36/54 (66%), Positives = 44/54 (81%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 E +EQS I F S++SE+E I Q+L+PK+QFNL L+EKER DR KVVLPFEHQG Sbjct: 241 EFCIEQSGIIFTSISSEDEKINQSLLPKLQFNLQLSEKERIDRAKVVLPFEHQG 294 >XP_015881340.1 PREDICTED: elongator complex protein 5-like isoform X1 [Ziziphus jujuba] XP_015867534.1 PREDICTED: elongator complex protein 5-like isoform X1 [Ziziphus jujuba] Length = 376 Score = 74.3 bits (181), Expect = 2e-13 Identities = 36/54 (66%), Positives = 44/54 (81%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 E +EQS I F S++SE+E I Q+L+PK+QFNL L+EKER DR KVVLPFEHQG Sbjct: 260 EFCIEQSGIIFTSISSEDEKINQSLLPKLQFNLQLSEKERIDRAKVVLPFEHQG 313 >XP_009798036.1 PREDICTED: elongator complex protein 5 isoform X2 [Nicotiana sylvestris] XP_016444599.1 PREDICTED: elongator complex protein 5-like isoform X2 [Nicotiana tabacum] Length = 351 Score = 73.9 bits (180), Expect = 3e-13 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 EL VE S+I+F ++SE+ AQ+LVPKVQFNL L+EKER DR KVVLPFEHQG Sbjct: 235 ELYVEGSDIKFKEVSSEDGMTAQSLVPKVQFNLELSEKERLDRAKVVLPFEHQG 288 >XP_009798035.1 PREDICTED: elongator complex protein 5 isoform X1 [Nicotiana sylvestris] XP_016444598.1 PREDICTED: elongator complex protein 5-like isoform X1 [Nicotiana tabacum] Length = 376 Score = 73.9 bits (180), Expect = 3e-13 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 EL VE S+I+F ++SE+ AQ+LVPKVQFNL L+EKER DR KVVLPFEHQG Sbjct: 260 ELYVEGSDIKFKEVSSEDGMTAQSLVPKVQFNLELSEKERLDRAKVVLPFEHQG 313 >XP_010693201.1 PREDICTED: elongator complex protein 5 [Beta vulgaris subsp. vulgaris] KMT18562.1 hypothetical protein BVRB_2g026960 [Beta vulgaris subsp. vulgaris] Length = 368 Score = 73.6 bits (179), Expect = 4e-13 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQ 180 E+ V+QS I F S++S EE++AQ LVPKVQFNL L+EKE+ DR KVVLPFEHQ Sbjct: 255 EVYVKQSGISFTSISSSEESMAQTLVPKVQFNLQLSEKEQIDRSKVVLPFEHQ 307 >GAV89541.1 Hap2_elong domain-containing protein [Cephalotus follicularis] Length = 370 Score = 73.6 bits (179), Expect = 4e-13 Identities = 36/54 (66%), Positives = 42/54 (77%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 E +E S I F SL+SE+ + Q LVPKVQFNL L+EKER+DR KVVLPFEHQG Sbjct: 254 EFYLEHSGINFTSLSSEDGLVYQGLVPKVQFNLQLSEKERDDRAKVVLPFEHQG 307 >XP_019262098.1 PREDICTED: elongator complex protein 5 [Nicotiana attenuata] OIT38036.1 elongator complex protein 5 [Nicotiana attenuata] Length = 376 Score = 73.6 bits (179), Expect = 5e-13 Identities = 37/54 (68%), Positives = 43/54 (79%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 EL VE S I+F ++SE+ AQ+LVPKVQFNL L+EKER DR KVVLPFEHQG Sbjct: 260 ELYVEGSSIKFKEISSEDGMTAQSLVPKVQFNLELSEKERLDRAKVVLPFEHQG 313 >KNA25865.1 hypothetical protein SOVF_001720 [Spinacia oleracea] Length = 368 Score = 73.2 bits (178), Expect = 6e-13 Identities = 37/53 (69%), Positives = 42/53 (79%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQ 180 E+ VEQS I F S+ SEEE +AQ LVPKV FNL L+EKE+ DR KVVLPFEHQ Sbjct: 253 EVHVEQSGIAFKSILSEEELMAQTLVPKVHFNLELSEKEQIDRSKVVLPFEHQ 305 >XP_006653258.1 PREDICTED: elongator complex protein 5-like [Oryza brachyantha] Length = 382 Score = 73.2 bits (178), Expect = 6e-13 Identities = 35/54 (64%), Positives = 43/54 (79%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 EL VE +E+RFVS+ S + Q+L+PKVQFNL L+EKER+DR VVLPFEHQG Sbjct: 264 ELHVEGNEVRFVSMPSVSTEVNQSLLPKVQFNLELSEKERSDRANVVLPFEHQG 317 >XP_016510723.1 PREDICTED: elongator complex protein 5-like isoform X2 [Nicotiana tabacum] XP_018633115.1 PREDICTED: elongator complex protein 5 isoform X2 [Nicotiana tomentosiformis] Length = 351 Score = 72.4 bits (176), Expect = 1e-12 Identities = 37/54 (68%), Positives = 43/54 (79%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 EL VE S I+F ++SE+ AQ+LVPKVQFNL L+EKER DR KVVLPFEHQG Sbjct: 235 ELYVEGSGIKFKEVSSEDGMTAQSLVPKVQFNLELSEKERLDRAKVVLPFEHQG 288 >ONK76988.1 uncharacterized protein A4U43_C02F1960 [Asparagus officinalis] Length = 371 Score = 72.4 bits (176), Expect = 1e-12 Identities = 33/54 (61%), Positives = 44/54 (81%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 + +EQ I+F +++SE A+ Q+LVPKVQFNL L+EKE++DR KVVLPFEHQG Sbjct: 253 DFHMEQGGIKFTAVSSENTAVNQSLVPKVQFNLQLSEKEKDDRAKVVLPFEHQG 306 >XP_009625000.1 PREDICTED: elongator complex protein 5 isoform X1 [Nicotiana tomentosiformis] XP_016510722.1 PREDICTED: elongator complex protein 5-like isoform X1 [Nicotiana tabacum] Length = 376 Score = 72.4 bits (176), Expect = 1e-12 Identities = 37/54 (68%), Positives = 43/54 (79%) Frame = -2 Query: 338 ELSVEQSEIRFVSLTSEEEAIAQNLVPKVQFNLHLTEKERNDREKVVLPFEHQG 177 EL VE S I+F ++SE+ AQ+LVPKVQFNL L+EKER DR KVVLPFEHQG Sbjct: 260 ELYVEGSGIKFKEVSSEDGMTAQSLVPKVQFNLELSEKERLDRAKVVLPFEHQG 313