BLASTX nr result
ID: Lithospermum23_contig00045894
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00045894 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009799042.1 PREDICTED: uncharacterized protein LOC104245175 [... 55 3e-06 >XP_009799042.1 PREDICTED: uncharacterized protein LOC104245175 [Nicotiana sylvestris] XP_009799043.1 PREDICTED: uncharacterized protein LOC104245175 [Nicotiana sylvestris] XP_009799044.1 PREDICTED: uncharacterized protein LOC104245175 [Nicotiana sylvestris] Length = 284 Score = 54.7 bits (130), Expect = 3e-06 Identities = 18/38 (47%), Positives = 32/38 (84%) Frame = +2 Query: 239 ENKKGFMQCDHYGMKGHVRDTCYRLKGYPEGFGSRNQR 352 ++KK FM+CDH+GMKGH+++ CY++ GYP+ F ++ ++ Sbjct: 202 KSKKPFMKCDHFGMKGHLKENCYKIIGYPDDFKNKKRQ 239