BLASTX nr result
ID: Lithospermum23_contig00045840
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00045840 (268 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB09802.1 hypothetical protein B456_001G167800 [Gossypium raimo... 66 7e-11 YP_009049681.1 hypothetical protein (mitochondrion) [Capsicum an... 59 3e-09 XP_010098133.1 hypothetical protein L484_026267 [Morus notabilis... 51 9e-06 >KJB09802.1 hypothetical protein B456_001G167800 [Gossypium raimondii] Length = 330 Score = 66.2 bits (160), Expect = 7e-11 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 95 MAIRS*IKAIILEYRQNDSENSLSFPDRRRIIGTPTPGRV 214 MAIR+ I+ II EY QND ENSLSFPDRRRIIGTPTPGR+ Sbjct: 1 MAIRTEIRLIIQEYIQNDRENSLSFPDRRRIIGTPTPGRI 40 >YP_009049681.1 hypothetical protein (mitochondrion) [Capsicum annuum] AIG89912.1 hypothetical protein (mitochondrion) [Capsicum annuum] AIG90039.1 hypothetical protein (mitochondrion) [Capsicum annuum] Length = 107 Score = 58.5 bits (140), Expect = 3e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +2 Query: 179 RRIIGTPTPGRVSEPCNR*PFRAVRGALES 268 RRIIGT TPGRVSEPCNR PFRAVRGALES Sbjct: 38 RRIIGTHTPGRVSEPCNRRPFRAVRGALES 67 >XP_010098133.1 hypothetical protein L484_026267 [Morus notabilis] EXB74570.1 hypothetical protein L484_026267 [Morus notabilis] Length = 169 Score = 50.8 bits (120), Expect(2) = 9e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +2 Query: 197 PTPGRVSEPCNR*PFRAVRGALES 268 PTPGRVSEPCNR PFRAVRGALES Sbjct: 124 PTPGRVSEPCNRRPFRAVRGALES 147 Score = 25.8 bits (55), Expect(2) = 9e-06 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 175 PPTNNRYPHP 204 PPTNNRYP P Sbjct: 117 PPTNNRYPTP 126