BLASTX nr result
ID: Lithospermum23_contig00045827
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00045827 (396 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS74398.1 hypothetical protein M569_00361, partial [Genlisea au... 65 1e-11 YP_001152105.1 ORF66a [Pinus koraiensis] ABP35351.1 ORF66a (chlo... 55 1e-07 OMP07461.1 hypothetical protein CCACVL1_01298 [Corchorus capsula... 51 2e-06 >EPS74398.1 hypothetical protein M569_00361, partial [Genlisea aurea] Length = 56 Score = 65.1 bits (157), Expect = 1e-11 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -1 Query: 330 RGVAQLGSAFVLGTKCHRFKSCHPYLLLFKRQIEKRAVTRDLLRSIQ 190 R VAQLGSAFVLGTKCH FKSCHPYLLL KRAV+++ +RSI+ Sbjct: 1 RDVAQLGSAFVLGTKCHGFKSCHPYLLLL-----KRAVSQNKVRSIE 42 >YP_001152105.1 ORF66a [Pinus koraiensis] ABP35351.1 ORF66a (chloroplast) [Pinus koraiensis] Length = 66 Score = 55.1 bits (131), Expect = 1e-07 Identities = 33/62 (53%), Positives = 38/62 (61%), Gaps = 3/62 (4%) Frame = -1 Query: 330 RGVAQLGSAFVLGTKCHRFKSCHPYLLLFKRQIEKRAVTRDLLRSIQN*R---ESFSLWS 160 R VAQLGS FVLGTKC RFKSCHPYL L + T+D L SI+ ES+ + Sbjct: 4 RDVAQLGSVFVLGTKCRRFKSCHPYLSLL---FYGKKGTKDHLISIRREHQIIESYQMRK 60 Query: 159 YL 154 YL Sbjct: 61 YL 62 >OMP07461.1 hypothetical protein CCACVL1_01298 [Corchorus capsularis] OMP14090.1 ATP synthase subunit a chloroplastic [Corchorus olitorius] Length = 31 Score = 50.8 bits (120), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 262 MTGFEPVTFCTQNKRATKLRYTP 330 MTGFEPVTFCTQNKRATKLRY P Sbjct: 1 MTGFEPVTFCTQNKRATKLRYIP 23