BLASTX nr result
ID: Lithospermum23_contig00045628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00045628 (220 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABK94322.1 unknown [Populus trichocarpa] 63 3e-11 XP_016737284.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-li... 64 3e-11 KJB39530.1 hypothetical protein B456_007G018900 [Gossypium raimo... 65 1e-10 XP_002518930.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11 [R... 65 1e-10 XP_015866199.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Z... 65 1e-10 KHG16903.1 hypothetical protein F383_04540 [Gossypium arboreum] 65 1e-10 XP_017231028.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-li... 65 1e-10 XP_011040600.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-li... 65 1e-10 XP_017607844.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-li... 65 1e-10 XP_016710800.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-li... 65 1e-10 XP_012488659.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-li... 65 1e-10 XP_017607843.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-li... 65 1e-10 XP_016710799.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-li... 65 1e-10 XP_012488658.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-li... 65 1e-10 OAY59745.1 hypothetical protein MANES_01G056000 [Manihot esculenta] 65 1e-10 XP_012086629.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-li... 65 1e-10 KNA20791.1 hypothetical protein SOVF_048840 [Spinacia oleracea] 65 2e-10 KJB52394.1 hypothetical protein B456_008G260000 [Gossypium raimo... 64 2e-10 XP_017637199.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-li... 64 2e-10 XP_016716507.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-li... 64 2e-10 >ABK94322.1 unknown [Populus trichocarpa] Length = 107 Score = 63.2 bits (152), Expect = 3e-11 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGP SERN+GLFK DGTPAYSLG+ Sbjct: 13 ALFNENMKPGPASERNYGLFKPDGTPAYSLGI 44 >XP_016737284.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Gossypium hirsutum] Length = 164 Score = 64.3 bits (155), Expect = 3e-11 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAY+LGV Sbjct: 77 ALFNENMKPGPTSERNYGLFKPDGTPAYALGV 108 >KJB39530.1 hypothetical protein B456_007G018900 [Gossypium raimondii] Length = 404 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 346 >XP_002518930.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Ricinus communis] EEF43463.1 Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] Length = 405 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 313 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 344 >XP_015866199.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Ziziphus jujuba] Length = 407 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 312 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 343 >KHG16903.1 hypothetical protein F383_04540 [Gossypium arboreum] Length = 408 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 346 >XP_017231028.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Daucus carota subsp. sativus] KZN05728.1 hypothetical protein DCAR_006565 [Daucus carota subsp. sativus] Length = 409 Score = 65.1 bits (157), Expect = 1e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNENLKPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 310 ALFNENLKPGPTSERNYGLFKPDGTPAYSLGL 341 >XP_011040600.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Populus euphratica] Length = 412 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 346 >XP_017607844.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X2 [Gossypium arboreum] Length = 413 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 346 >XP_016710800.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X2 [Gossypium hirsutum] Length = 413 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 346 >XP_012488659.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X2 [Gossypium raimondii] KJB39529.1 hypothetical protein B456_007G018900 [Gossypium raimondii] Length = 413 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 346 >XP_017607843.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X1 [Gossypium arboreum] Length = 414 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 346 >XP_016710799.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X1 [Gossypium hirsutum] Length = 414 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 346 >XP_012488658.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X1 [Gossypium raimondii] Length = 414 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 346 >OAY59745.1 hypothetical protein MANES_01G056000 [Manihot esculenta] Length = 416 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 318 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 349 >XP_012086629.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Jatropha curcas] KDP25221.1 hypothetical protein JCGZ_20377 [Jatropha curcas] Length = 416 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAYSLG+ Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYSLGI 346 >KNA20791.1 hypothetical protein SOVF_048840 [Spinacia oleracea] Length = 400 Score = 64.7 bits (156), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLG 95 ALFNENLKPGPTSERN+GLFK DGTPAYSLG Sbjct: 299 ALFNENLKPGPTSERNYGLFKPDGTPAYSLG 329 >KJB52394.1 hypothetical protein B456_008G260000 [Gossypium raimondii] Length = 389 Score = 64.3 bits (155), Expect = 2e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAY+LGV Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYALGV 346 >XP_017637199.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Gossypium arboreum] Length = 402 Score = 64.3 bits (155), Expect = 2e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAY+LGV Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYALGV 346 >XP_016716507.1 PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Gossypium hirsutum] Length = 402 Score = 64.3 bits (155), Expect = 2e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALFNENLKPGPTSERNFGLFKNDGTPAYSLGV 98 ALFNEN+KPGPTSERN+GLFK DGTPAY+LGV Sbjct: 315 ALFNENMKPGPTSERNYGLFKPDGTPAYALGV 346