BLASTX nr result
ID: Lithospermum23_contig00045450
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00045450 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010092177.1 Zinc finger protein 3 [Morus notabilis] EXB50403.... 52 4e-06 >XP_010092177.1 Zinc finger protein 3 [Morus notabilis] EXB50403.1 Zinc finger protein 3 [Morus notabilis] Length = 257 Score = 52.4 bits (124), Expect = 4e-06 Identities = 28/60 (46%), Positives = 33/60 (55%) Frame = +1 Query: 67 KNKISIMESNHIEEQDQNQVEDTSRILDLSLSSKESNHGSTPELNLIDSFDLLSSDQQKD 246 K K+ E N EE DQ +D +LDLSL S+ GS PELN ID FD SS+ D Sbjct: 30 KLKVQEEEGNSYEENDQEDTKDVHLVLDLSLPINNSDQGSKPELNFIDCFDSNSSETCPD 89