BLASTX nr result
ID: Lithospermum23_contig00045302
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00045302 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017246460.1 PREDICTED: methyl-CpG-binding domain-containing p... 53 8e-06 XP_017246458.1 PREDICTED: methyl-CpG-binding domain-containing p... 53 8e-06 >XP_017246460.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X2 [Daucus carota subsp. sativus] Length = 316 Score = 53.1 bits (126), Expect = 8e-06 Identities = 24/54 (44%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = +2 Query: 191 IEERSGGSTTELALVPAAATR-SHPFRLPRGWKIEGVPRSTYPYQIDKYYIEPG 349 + + G ++A+VPA T S P++LP GW +E VPR+T+ +DKYY EPG Sbjct: 140 LANKDGPDKYKMAIVPARKTPFSSPYQLPEGWVVEEVPRNTHGGYVDKYYYEPG 193 >XP_017246458.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X1 [Daucus carota subsp. sativus] XP_017246459.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X1 [Daucus carota subsp. sativus] Length = 317 Score = 53.1 bits (126), Expect = 8e-06 Identities = 24/54 (44%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = +2 Query: 191 IEERSGGSTTELALVPAAATR-SHPFRLPRGWKIEGVPRSTYPYQIDKYYIEPG 349 + + G ++A+VPA T S P++LP GW +E VPR+T+ +DKYY EPG Sbjct: 141 LANKDGPDKYKMAIVPARKTPFSSPYQLPEGWVVEEVPRNTHGGYVDKYYYEPG 194