BLASTX nr result
ID: Lithospermum23_contig00045090
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00045090 (300 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009627383.1 PREDICTED: protein yippee-like At4g27740 [Nicotia... 58 2e-08 XP_019248981.1 PREDICTED: protein yippee-like At4g27740 [Nicotia... 55 3e-07 XP_009757022.1 PREDICTED: protein yippee-like At4g27745 [Nicotia... 54 7e-07 >XP_009627383.1 PREDICTED: protein yippee-like At4g27740 [Nicotiana tomentosiformis] Length = 134 Score = 57.8 bits (138), Expect = 2e-08 Identities = 23/40 (57%), Positives = 32/40 (80%) Frame = -2 Query: 122 NDPTQAFYICRICTSQIALSDSFNYYYTPETGLTGGVFDE 3 +DP+ FY+CRIC + +ALS+ F+ YTP TG+TGGVFD+ Sbjct: 12 SDPSLRFYMCRICQNHVALSEDFSLNYTPATGVTGGVFDK 51 >XP_019248981.1 PREDICTED: protein yippee-like At4g27740 [Nicotiana attenuata] OIT02323.1 protein yippee-like protein [Nicotiana attenuata] Length = 161 Score = 55.1 bits (131), Expect = 3e-07 Identities = 21/40 (52%), Positives = 31/40 (77%) Frame = -2 Query: 122 NDPTQAFYICRICTSQIALSDSFNYYYTPETGLTGGVFDE 3 +DP+ FY+CRIC + +AL+ F+ YTP +G+TGGVFD+ Sbjct: 12 SDPSLRFYVCRICQNHVALTQDFSLNYTPASGVTGGVFDK 51 >XP_009757022.1 PREDICTED: protein yippee-like At4g27745 [Nicotiana sylvestris] XP_016496784.1 PREDICTED: protein yippee-like At4g27745 [Nicotiana tabacum] Length = 133 Score = 53.5 bits (127), Expect = 7e-07 Identities = 21/40 (52%), Positives = 30/40 (75%) Frame = -2 Query: 122 NDPTQAFYICRICTSQIALSDSFNYYYTPETGLTGGVFDE 3 +DP+ FY+C IC + +AL+ F+ YTP TG+TGGVFD+ Sbjct: 12 SDPSLRFYVCCICQNHVALTQDFSLNYTPATGVTGGVFDK 51