BLASTX nr result
ID: Lithospermum23_contig00044883
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00044883 (245 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019059646.1 PREDICTED: uncharacterized protein LOC104827423 [... 66 6e-11 KZV26810.1 U-box domain-containing protein 35-like [Dorcoceras h... 64 3e-10 XP_011019963.1 PREDICTED: U-box domain-containing protein 34-lik... 62 2e-09 XP_012855943.1 PREDICTED: U-box domain-containing protein 34-lik... 62 2e-09 OMO53245.1 hypothetical protein CCACVL1_28776 [Corchorus capsula... 62 2e-09 XP_016684481.1 PREDICTED: U-box domain-containing protein 35-lik... 62 3e-09 XP_016690237.1 PREDICTED: U-box domain-containing protein 35-lik... 62 3e-09 XP_017623013.1 PREDICTED: U-box domain-containing protein 52-lik... 62 3e-09 KJB53689.1 hypothetical protein B456_009G001200 [Gossypium raimo... 62 3e-09 XP_012444177.1 PREDICTED: U-box domain-containing protein 35 [Go... 62 3e-09 XP_002309024.1 kinase family protein [Populus trichocarpa] EEE92... 61 4e-09 CDP12490.1 unnamed protein product [Coffea canephora] 61 4e-09 XP_017983400.1 PREDICTED: U-box domain-containing protein 35 iso... 61 5e-09 XP_017983399.1 PREDICTED: U-box domain-containing protein 35 iso... 61 5e-09 XP_017983395.1 PREDICTED: U-box domain-containing protein 35 iso... 61 5e-09 EOY32180.1 Kinase protein with adenine nucleotide alpha hydrolas... 61 5e-09 EYU22082.1 hypothetical protein MIMGU_mgv1a001807mg [Erythranthe... 60 7e-09 XP_012855944.1 PREDICTED: U-box domain-containing protein 34-lik... 60 7e-09 XP_006453185.1 hypothetical protein CICLE_v10010281mg, partial [... 60 1e-08 KDO62030.1 hypothetical protein CISIN_1g035604mg [Citrus sinensis] 60 1e-08 >XP_019059646.1 PREDICTED: uncharacterized protein LOC104827423 [Tarenaya hassleriana] Length = 288 Score = 65.9 bits (159), Expect = 6e-11 Identities = 27/49 (55%), Positives = 38/49 (77%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQQI 9 R+F ++D+S +V KGAP FC VY I++GKI++ RTATC PP P +QQ+ Sbjct: 6 RRFKASDVSSSVMKGAPNFCTVYAISRGKISSARTATCSPPRTPVQQQL 54 >KZV26810.1 U-box domain-containing protein 35-like [Dorcoceras hygrometricum] Length = 767 Score = 64.3 bits (155), Expect = 3e-10 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQQIHQ 3 R+F DI GNVSKGAPEFCNVYVI+KGKI++VR+A+ P P Q +Q Sbjct: 119 RRFKIVDIPGNVSKGAPEFCNVYVISKGKISSVRSASLSVPKESPPQLQNQ 169 >XP_011019963.1 PREDICTED: U-box domain-containing protein 34-like [Populus euphratica] Length = 673 Score = 62.4 bits (150), Expect = 2e-09 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQ 15 RKF + D+ GNVSKGAP FC+VYVI+KGKI++VR+A+ PP P Q Sbjct: 9 RKFKTTDVPGNVSKGAPGFCSVYVISKGKISSVRSASGPPPPKHPIQ 55 >XP_012855943.1 PREDICTED: U-box domain-containing protein 34-like isoform X1 [Erythranthe guttata] Length = 782 Score = 62.4 bits (150), Expect = 2e-09 Identities = 31/51 (60%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPS--GPPRQQI 9 R+F + DI G+V KGAP+FCNVYVINKGKI++ R A+ PPS P R QI Sbjct: 144 RRFKAKDIPGSVLKGAPDFCNVYVINKGKISSTRAASRPPPSIFSPLRNQI 194 >OMO53245.1 hypothetical protein CCACVL1_28776 [Corchorus capsularis] Length = 778 Score = 62.0 bits (149), Expect = 2e-09 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPR 18 R+F + D+ NV+KG P++C VYVI KGKI++V++AT PP+ PPR Sbjct: 130 RRFRTTDVPTNVTKGVPDYCTVYVIGKGKISSVKSATAPPPAKPPR 175 >XP_016684481.1 PREDICTED: U-box domain-containing protein 35-like [Gossypium hirsutum] Length = 352 Score = 61.6 bits (148), Expect = 3e-09 Identities = 26/51 (50%), Positives = 39/51 (76%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQQIHQ 3 R+F +A+++ NVSKGAP++C +YVI KGKI++VR+A+ PP P Q + Q Sbjct: 138 RRFRTAEVTTNVSKGAPDYCTIYVIGKGKISSVRSASAPPPPRPQSQPLLQ 188 >XP_016690237.1 PREDICTED: U-box domain-containing protein 35-like [Gossypium hirsutum] Length = 718 Score = 61.6 bits (148), Expect = 3e-09 Identities = 26/51 (50%), Positives = 39/51 (76%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQQIHQ 3 R+F +A+++ NVSKGAP++C +YVI KGKI++VR+A+ PP P Q + Q Sbjct: 76 RRFRTAEVTTNVSKGAPDYCTIYVIGKGKISSVRSASAPPPPRPQSQPLLQ 126 >XP_017623013.1 PREDICTED: U-box domain-containing protein 52-like [Gossypium arboreum] Length = 778 Score = 61.6 bits (148), Expect = 3e-09 Identities = 26/51 (50%), Positives = 39/51 (76%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQQIHQ 3 R+F +A+++ NVSKGAP++C +YVI KGKI++VR+A+ PP P Q + Q Sbjct: 138 RRFRTAEVTTNVSKGAPDYCTIYVIGKGKISSVRSASAPPPPRPQSQPLLQ 188 >KJB53689.1 hypothetical protein B456_009G001200 [Gossypium raimondii] Length = 782 Score = 61.6 bits (148), Expect = 3e-09 Identities = 26/51 (50%), Positives = 39/51 (76%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQQIHQ 3 R+F +A+++ NVSKGAP++C +YVI KGKI++VR+A+ PP P Q + Q Sbjct: 144 RRFRTAEVTTNVSKGAPDYCTIYVIGKGKISSVRSASAPPPPRPQSQPLLQ 194 >XP_012444177.1 PREDICTED: U-box domain-containing protein 35 [Gossypium raimondii] Length = 786 Score = 61.6 bits (148), Expect = 3e-09 Identities = 26/51 (50%), Positives = 39/51 (76%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQQIHQ 3 R+F +A+++ NVSKGAP++C +YVI KGKI++VR+A+ PP P Q + Q Sbjct: 144 RRFRTAEVTTNVSKGAPDYCTIYVIGKGKISSVRSASAPPPPRPQSQPLLQ 194 >XP_002309024.1 kinase family protein [Populus trichocarpa] EEE92547.1 kinase family protein [Populus trichocarpa] Length = 687 Score = 61.2 bits (147), Expect = 4e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPP 33 RKF + DI GNVSKGAP FC+VYVI+KGKI++VR+A+ PP Sbjct: 136 RKFKTTDIPGNVSKGAPGFCSVYVISKGKISSVRSASGPPP 176 >CDP12490.1 unnamed protein product [Coffea canephora] Length = 800 Score = 61.2 bits (147), Expect = 4e-09 Identities = 26/51 (50%), Positives = 39/51 (76%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQQIHQ 3 R+F + D++ VSK AP+FCNV+ I+KGK+++VR A+C P+ PPRQ +Q Sbjct: 174 RRFKTNDVASTVSKVAPDFCNVFTISKGKLSSVRAASCPVPNPPPRQGQNQ 224 >XP_017983400.1 PREDICTED: U-box domain-containing protein 35 isoform X4 [Theobroma cacao] Length = 785 Score = 60.8 bits (146), Expect = 5e-09 Identities = 26/50 (52%), Positives = 38/50 (76%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQQIH 6 R+F ++D+ NVSKGAP++C VYVI KGKI++VR+A+ PP+ P + H Sbjct: 139 RRFRTSDVPTNVSKGAPDYCTVYVIGKGKISSVRSASAPPPTRPLPPRAH 188 >XP_017983399.1 PREDICTED: U-box domain-containing protein 35 isoform X3 [Theobroma cacao] Length = 788 Score = 60.8 bits (146), Expect = 5e-09 Identities = 26/50 (52%), Positives = 38/50 (76%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQQIH 6 R+F ++D+ NVSKGAP++C VYVI KGKI++VR+A+ PP+ P + H Sbjct: 139 RRFRTSDVPTNVSKGAPDYCTVYVIGKGKISSVRSASAPPPTRPLPPRAH 188 >XP_017983395.1 PREDICTED: U-box domain-containing protein 35 isoform X1 [Theobroma cacao] XP_017983396.1 PREDICTED: U-box domain-containing protein 35 isoform X1 [Theobroma cacao] Length = 799 Score = 60.8 bits (146), Expect = 5e-09 Identities = 26/50 (52%), Positives = 38/50 (76%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQQIH 6 R+F ++D+ NVSKGAP++C VYVI KGKI++VR+A+ PP+ P + H Sbjct: 139 RRFRTSDVPTNVSKGAPDYCTVYVIGKGKISSVRSASAPPPTRPLPPRAH 188 >EOY32180.1 Kinase protein with adenine nucleotide alpha hydrolases-like domain, putative isoform 1 [Theobroma cacao] Length = 799 Score = 60.8 bits (146), Expect = 5e-09 Identities = 26/50 (52%), Positives = 38/50 (76%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPSGPPRQQIH 6 R+F ++D+ NVSKGAP++C VYVI KGKI++VR+A+ PP+ P + H Sbjct: 139 RRFRTSDVPTNVSKGAPDYCTVYVIGKGKISSVRSASAPPPTRPLPPRAH 188 >EYU22082.1 hypothetical protein MIMGU_mgv1a001807mg [Erythranthe guttata] Length = 757 Score = 60.5 bits (145), Expect = 7e-09 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = -1 Query: 152 KFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPS--GPPRQQI 9 +F + DI G+V KGAP+FCNVYVINKGKI++ R A+ PPS P R QI Sbjct: 144 RFKAKDIPGSVLKGAPDFCNVYVINKGKISSTRAASRPPPSIFSPLRNQI 193 >XP_012855944.1 PREDICTED: U-box domain-containing protein 34-like isoform X2 [Erythranthe guttata] Length = 781 Score = 60.5 bits (145), Expect = 7e-09 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = -1 Query: 152 KFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPPS--GPPRQQI 9 +F + DI G+V KGAP+FCNVYVINKGKI++ R A+ PPS P R QI Sbjct: 144 RFKAKDIPGSVLKGAPDFCNVYVINKGKISSTRAASRPPPSIFSPLRNQI 193 >XP_006453185.1 hypothetical protein CICLE_v10010281mg, partial [Citrus clementina] ESR66425.1 hypothetical protein CICLE_v10010281mg, partial [Citrus clementina] Length = 725 Score = 59.7 bits (143), Expect = 1e-08 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPP 33 ++F +ADI NVSKGAP++CNVYVI KGKI++VR+AT P Sbjct: 138 KRFKTADIPSNVSKGAPDYCNVYVIGKGKISSVRSATASVP 178 >KDO62030.1 hypothetical protein CISIN_1g035604mg [Citrus sinensis] Length = 768 Score = 59.7 bits (143), Expect = 1e-08 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 155 RKFMSADISGNVSKGAPEFCNVYVINKGKIATVRTATCHPP 33 ++F +ADI NVSKGAP++CNVYVI KGKI++VR+AT P Sbjct: 138 KRFKTADIPSNVSKGAPDYCNVYVIGKGKISSVRSATASVP 178