BLASTX nr result
ID: Lithospermum23_contig00044729
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00044729 (280 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI09639.1 Ovate protein family, C-terminal [Cynara cardunculus ... 101 1e-24 CAN62024.1 hypothetical protein VITISV_004927 [Vitis vinifera] 100 3e-24 XP_002269135.1 PREDICTED: transcription repressor OFP13 [Vitis v... 100 3e-24 XP_012082193.1 PREDICTED: transcription repressor OFP13 [Jatroph... 99 6e-24 XP_007214128.1 hypothetical protein PRUPE_ppa018010mg [Prunus pe... 100 7e-24 KDO43030.1 hypothetical protein CISIN_1g035731mg [Citrus sinensis] 99 7e-24 ONI21524.1 hypothetical protein PRUPE_2G071500 [Prunus persica] 100 8e-24 KCW50561.1 hypothetical protein EUGRSUZ_J00277, partial [Eucalyp... 99 9e-24 XP_006445767.1 hypothetical protein CICLE_v10016377mg [Citrus cl... 99 1e-23 XP_010031300.2 PREDICTED: transcription repressor OFP13 [Eucalyp... 99 2e-23 XP_017234440.1 PREDICTED: transcription repressor OFP13-like [Da... 98 4e-23 XP_011076850.1 PREDICTED: transcription repressor OFP13 [Sesamum... 98 5e-23 XP_011032908.1 PREDICTED: transcription repressor OFP13 [Populus... 97 6e-23 XP_002310994.2 hypothetical protein POPTR_0008s01840g [Populus t... 97 6e-23 XP_018835347.1 PREDICTED: transcription repressor OFP13-like [Ju... 97 8e-23 XP_018858345.1 PREDICTED: transcription repressor OFP13-like [Ju... 97 9e-23 XP_018835328.1 PREDICTED: transcription repressor OFP13-like [Ju... 97 9e-23 EYU19830.1 hypothetical protein MIMGU_mgv1a022507mg, partial [Er... 97 9e-23 CDO99927.1 unnamed protein product [Coffea canephora] 97 1e-22 XP_012858212.1 PREDICTED: transcription repressor OFP13 [Erythra... 97 2e-22 >KVI09639.1 Ovate protein family, C-terminal [Cynara cardunculus var. scolymus] Length = 246 Score = 101 bits (252), Expect = 1e-24 Identities = 44/63 (69%), Positives = 55/63 (87%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV+M M+S+NPY DFKKSM+EM+ES GLKDW+CLEELLRWYLRMN + +HE I+ AF+D+ Sbjct: 139 SVVMEMESDNPYGDFKKSMEEMVESHGLKDWDCLEELLRWYLRMNGKNNHEVIVGAFVDL 198 Query: 183 LIG 191 L G Sbjct: 199 LSG 201 >CAN62024.1 hypothetical protein VITISV_004927 [Vitis vinifera] Length = 226 Score = 100 bits (248), Expect = 3e-24 Identities = 42/63 (66%), Positives = 57/63 (90%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++AM+SE+PY DF+KSM+EM+ES GLKDW+CLEELL WYLR+N +K+H FI+ AF+D+ Sbjct: 122 SVVLAMESEDPYVDFRKSMEEMVESHGLKDWDCLEELLGWYLRVNGKKNHGFIVGAFVDL 181 Query: 183 LIG 191 L+G Sbjct: 182 LVG 184 >XP_002269135.1 PREDICTED: transcription repressor OFP13 [Vitis vinifera] CBI25021.3 unnamed protein product, partial [Vitis vinifera] Length = 226 Score = 100 bits (248), Expect = 3e-24 Identities = 42/63 (66%), Positives = 57/63 (90%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++AM+SE+PY DF+KSM+EM+ES GLKDW+CLEELL WYLR+N +K+H FI+ AF+D+ Sbjct: 122 SVVLAMESEDPYVDFRKSMEEMVESHGLKDWDCLEELLGWYLRVNGKKNHGFIVGAFVDL 181 Query: 183 LIG 191 L+G Sbjct: 182 LVG 184 >XP_012082193.1 PREDICTED: transcription repressor OFP13 [Jatropha curcas] KDP29272.1 hypothetical protein JCGZ_19437 [Jatropha curcas] Length = 220 Score = 99.4 bits (246), Expect = 6e-24 Identities = 41/62 (66%), Positives = 57/62 (91%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++A++SENPY DF++SM+EM+ES GLKDW+CLEELLRWYL++N +K+H FI+ AFID+ Sbjct: 105 SVVLALESENPYVDFRRSMEEMVESHGLKDWDCLEELLRWYLKVNGKKNHGFIVGAFIDL 164 Query: 183 LI 188 L+ Sbjct: 165 LV 166 >XP_007214128.1 hypothetical protein PRUPE_ppa018010mg [Prunus persica] Length = 244 Score = 99.8 bits (247), Expect = 7e-24 Identities = 41/62 (66%), Positives = 58/62 (93%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++AM+SE+PY+DF++SM+EM+ES GLKDWECLEELL WYLR+N++K+H FI+ AF+D+ Sbjct: 128 SVVLAMESEDPYKDFRRSMEEMVESHGLKDWECLEELLGWYLRVNKKKNHGFIVGAFLDL 187 Query: 183 LI 188 L+ Sbjct: 188 LV 189 >KDO43030.1 hypothetical protein CISIN_1g035731mg [Citrus sinensis] Length = 229 Score = 99.4 bits (246), Expect = 7e-24 Identities = 43/65 (66%), Positives = 57/65 (87%), Gaps = 1/65 (1%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGL-KDWECLEELLRWYLRMNEEKHHEFIIEAFID 179 SV++AMDSENPY DF++SM+EM+E+ GL KDW+CLEELL WYLR+N +KHH FI++AF+D Sbjct: 113 SVVLAMDSENPYVDFRRSMEEMVETHGLIKDWDCLEELLGWYLRVNGKKHHGFIVDAFVD 172 Query: 180 MLIGF 194 +L F Sbjct: 173 LLASF 177 >ONI21524.1 hypothetical protein PRUPE_2G071500 [Prunus persica] Length = 249 Score = 99.8 bits (247), Expect = 8e-24 Identities = 41/62 (66%), Positives = 58/62 (93%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++AM+SE+PY+DF++SM+EM+ES GLKDWECLEELL WYLR+N++K+H FI+ AF+D+ Sbjct: 133 SVVLAMESEDPYKDFRRSMEEMVESHGLKDWECLEELLGWYLRVNKKKNHGFIVGAFLDL 192 Query: 183 LI 188 L+ Sbjct: 193 LV 194 >KCW50561.1 hypothetical protein EUGRSUZ_J00277, partial [Eucalyptus grandis] Length = 237 Score = 99.4 bits (246), Expect = 9e-24 Identities = 42/62 (67%), Positives = 56/62 (90%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++AM+SENPY DF++SM+EM+ES GLKDWECLE LL WYLR+N +K+H FI+EAF+D+ Sbjct: 133 SVVLAMESENPYVDFRRSMEEMVESHGLKDWECLEALLGWYLRVNGKKNHGFIVEAFVDL 192 Query: 183 LI 188 L+ Sbjct: 193 LM 194 >XP_006445767.1 hypothetical protein CICLE_v10016377mg [Citrus clementina] XP_006485467.1 PREDICTED: transcription repressor OFP13 [Citrus sinensis] ESR59007.1 hypothetical protein CICLE_v10016377mg [Citrus clementina] Length = 251 Score = 99.4 bits (246), Expect = 1e-23 Identities = 43/65 (66%), Positives = 57/65 (87%), Gaps = 1/65 (1%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGL-KDWECLEELLRWYLRMNEEKHHEFIIEAFID 179 SV++AMDSENPY DF++SM+EM+E+ GL KDW+CLEELL WYLR+N +KHH FI++AF+D Sbjct: 136 SVVLAMDSENPYVDFRRSMEEMVETHGLIKDWDCLEELLGWYLRVNGKKHHGFIVDAFVD 195 Query: 180 MLIGF 194 +L F Sbjct: 196 LLASF 200 >XP_010031300.2 PREDICTED: transcription repressor OFP13 [Eucalyptus grandis] Length = 290 Score = 99.4 bits (246), Expect = 2e-23 Identities = 42/62 (67%), Positives = 56/62 (90%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++AM+SENPY DF++SM+EM+ES GLKDWECLE LL WYLR+N +K+H FI+EAF+D+ Sbjct: 178 SVVLAMESENPYVDFRRSMEEMVESHGLKDWECLEALLGWYLRVNGKKNHGFIVEAFVDL 237 Query: 183 LI 188 L+ Sbjct: 238 LM 239 >XP_017234440.1 PREDICTED: transcription repressor OFP13-like [Daucus carota subsp. sativus] KZN05494.1 hypothetical protein DCAR_006331 [Daucus carota subsp. sativus] Length = 255 Score = 98.2 bits (243), Expect = 4e-23 Identities = 41/63 (65%), Positives = 55/63 (87%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 S+++AM+SE+PYEDFK SM EM+ES GLKDWECLEELL WYL+MN + +H I++AF+D+ Sbjct: 155 SIVLAMESEDPYEDFKGSMLEMVESHGLKDWECLEELLEWYLKMNGKMNHGVIVQAFVDL 214 Query: 183 LIG 191 L+G Sbjct: 215 LVG 217 >XP_011076850.1 PREDICTED: transcription repressor OFP13 [Sesamum indicum] Length = 270 Score = 98.2 bits (243), Expect = 5e-23 Identities = 41/63 (65%), Positives = 55/63 (87%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV +A++S++PY DFKKSMQEM+ES GLK+W+CLEELL WYLRMN + +H FI+ AF+D+ Sbjct: 140 SVALALESDDPYSDFKKSMQEMVESHGLKEWDCLEELLGWYLRMNGKSNHGFIVGAFVDL 199 Query: 183 LIG 191 L+G Sbjct: 200 LVG 202 >XP_011032908.1 PREDICTED: transcription repressor OFP13 [Populus euphratica] Length = 214 Score = 96.7 bits (239), Expect = 6e-23 Identities = 39/63 (61%), Positives = 57/63 (90%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++AM+SE+PY DF++SM+EM+ES GLKDW+CLEELL WYL++N +K+H +I+ AF+D+ Sbjct: 115 SVVLAMESEDPYVDFRRSMEEMVESHGLKDWDCLEELLGWYLKVNGKKNHGYIVGAFVDL 174 Query: 183 LIG 191 L+G Sbjct: 175 LVG 177 >XP_002310994.2 hypothetical protein POPTR_0008s01840g [Populus trichocarpa] EEE88361.2 hypothetical protein POPTR_0008s01840g [Populus trichocarpa] Length = 214 Score = 96.7 bits (239), Expect = 6e-23 Identities = 39/63 (61%), Positives = 57/63 (90%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++AM+SE+PY DF++SM+EM+ES GLKDW+CLEELL WYL++N +K+H +I+ AF+D+ Sbjct: 115 SVVLAMESEDPYVDFRRSMEEMVESHGLKDWDCLEELLGWYLKVNGKKNHGYIVGAFVDL 174 Query: 183 LIG 191 L+G Sbjct: 175 LVG 177 >XP_018835347.1 PREDICTED: transcription repressor OFP13-like [Juglans regia] XP_018811155.1 PREDICTED: transcription repressor OFP13-like [Juglans regia] Length = 245 Score = 97.1 bits (240), Expect = 8e-23 Identities = 41/63 (65%), Positives = 56/63 (88%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++AM+S++PY DFK+SM+EM+ES G+KDW CLEELL WYLRMN +K+H FI+ AF+D+ Sbjct: 131 SVVLAMESKDPYIDFKRSMEEMVESHGVKDWGCLEELLGWYLRMNGKKNHGFIVGAFVDL 190 Query: 183 LIG 191 L+G Sbjct: 191 LVG 193 >XP_018858345.1 PREDICTED: transcription repressor OFP13-like [Juglans regia] Length = 233 Score = 96.7 bits (239), Expect = 9e-23 Identities = 41/63 (65%), Positives = 55/63 (87%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++AM+SE+PY DF++SM+EM+E GLKDWECLEELL WYL+MN +K+H FI+ AF+D+ Sbjct: 128 SVVLAMESEDPYLDFRRSMEEMVECHGLKDWECLEELLGWYLKMNGKKNHGFIVGAFVDL 187 Query: 183 LIG 191 L G Sbjct: 188 LCG 190 >XP_018835328.1 PREDICTED: transcription repressor OFP13-like [Juglans regia] XP_018856331.1 PREDICTED: transcription repressor OFP13-like [Juglans regia] XP_018816036.1 PREDICTED: transcription repressor OFP13-like [Juglans regia] XP_018853386.1 PREDICTED: transcription repressor OFP13-like [Juglans regia] Length = 233 Score = 96.7 bits (239), Expect = 9e-23 Identities = 41/63 (65%), Positives = 55/63 (87%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++AM+SE+PY DF++SM+EM+E GLKDWECLEELL WYL+MN +K+H FI+ AF+D+ Sbjct: 128 SVVLAMESEDPYLDFRRSMEEMVECHGLKDWECLEELLGWYLKMNGKKNHGFIVGAFVDL 187 Query: 183 LIG 191 L G Sbjct: 188 LCG 190 >EYU19830.1 hypothetical protein MIMGU_mgv1a022507mg, partial [Erythranthe guttata] Length = 250 Score = 97.1 bits (240), Expect = 9e-23 Identities = 42/63 (66%), Positives = 55/63 (87%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV +AM+SE+PY DFKKSM EM+ES GL+DW+CLEELLRWYL+MN + +H FI+ AF+D+ Sbjct: 155 SVAVAMESEDPYLDFKKSMAEMVESHGLEDWDCLEELLRWYLKMNGKINHGFIVGAFVDL 214 Query: 183 LIG 191 L+G Sbjct: 215 LVG 217 >CDO99927.1 unnamed protein product [Coffea canephora] Length = 254 Score = 96.7 bits (239), Expect = 1e-22 Identities = 42/63 (66%), Positives = 55/63 (87%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV++AM+SE+PY DFKKSM+EM+E+ GLKDWE LEELL WYL+MN + +H FI+ AF+D+ Sbjct: 133 SVVLAMESEDPYMDFKKSMEEMVETNGLKDWESLEELLGWYLKMNGQTNHGFIVGAFVDL 192 Query: 183 LIG 191 LIG Sbjct: 193 LIG 195 >XP_012858212.1 PREDICTED: transcription repressor OFP13 [Erythranthe guttata] Length = 290 Score = 97.1 bits (240), Expect = 2e-22 Identities = 42/63 (66%), Positives = 55/63 (87%) Frame = +3 Query: 3 SVMMAMDSENPYEDFKKSMQEMIESKGLKDWECLEELLRWYLRMNEEKHHEFIIEAFIDM 182 SV +AM+SE+PY DFKKSM EM+ES GL+DW+CLEELLRWYL+MN + +H FI+ AF+D+ Sbjct: 155 SVAVAMESEDPYLDFKKSMAEMVESHGLEDWDCLEELLRWYLKMNGKINHGFIVGAFVDL 214 Query: 183 LIG 191 L+G Sbjct: 215 LVG 217