BLASTX nr result
ID: Lithospermum23_contig00044420
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00044420 (569 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019167243.1 PREDICTED: random slug protein 5-like [Ipomoea nil] 77 1e-13 XP_015067566.1 PREDICTED: random slug protein 5 [Solanum pennellii] 76 2e-13 XP_004235849.1 PREDICTED: random slug protein 5 [Solanum lycoper... 75 6e-13 AFK49285.1 unknown [Lotus japonicus] 71 8e-13 XP_012856601.1 PREDICTED: random slug protein 5-like [Erythranth... 74 1e-12 XP_006341468.1 PREDICTED: random slug protein 5 [Solanum tuberosum] 74 2e-12 XP_006373203.1 hypothetical protein POPTR_0017s09620g [Populus t... 74 2e-12 KHN09704.1 Random slug protein 5 [Glycine soja] 73 4e-12 NP_001241473.1 uncharacterized protein LOC100797666 [Glycine max... 73 4e-12 XP_016171582.1 PREDICTED: random slug protein 5-like [Arachis ip... 73 4e-12 XP_015937934.1 PREDICTED: random slug protein 5-like [Arachis du... 73 4e-12 XP_009803039.1 PREDICTED: random slug protein 5-like [Nicotiana ... 72 6e-12 XP_004501761.1 PREDICTED: random slug protein 5-like [Cicer arie... 72 7e-12 KDO57636.1 hypothetical protein CISIN_1g043459mg [Citrus sinensis] 72 8e-12 XP_015387701.1 PREDICTED: CRAL-TRIO domain-containing protein YK... 72 8e-12 XP_006436972.1 hypothetical protein CICLE_v10032562mg [Citrus cl... 72 8e-12 XP_006485074.1 PREDICTED: CRAL-TRIO domain-containing protein YK... 72 8e-12 XP_016578402.1 PREDICTED: random slug protein 5-like [Capsicum a... 72 8e-12 XP_011073289.1 PREDICTED: random slug protein 5-like [Sesamum in... 72 9e-12 XP_017406154.1 PREDICTED: random slug protein 5-like [Vigna angu... 72 1e-11 >XP_019167243.1 PREDICTED: random slug protein 5-like [Ipomoea nil] Length = 253 Score = 76.6 bits (187), Expect = 1e-13 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVHN 135 IDNNTKKKI+FV++KRL STL+E IDESQLP++YGGK L+P+HN Sbjct: 208 IDNNTKKKIIFVENKRLTSTLLEDIDESQLPEIYGGKQPLVPIHN 252 >XP_015067566.1 PREDICTED: random slug protein 5 [Solanum pennellii] Length = 271 Score = 76.3 bits (186), Expect = 2e-13 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVH 132 IDNNTKKKI FV++KRL+ TL+E IDESQLPD+YGGKM L+P+H Sbjct: 226 IDNNTKKKITFVENKRLKETLLEDIDESQLPDIYGGKMPLVPIH 269 >XP_004235849.1 PREDICTED: random slug protein 5 [Solanum lycopersicum] Length = 271 Score = 75.1 bits (183), Expect = 6e-13 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVH 132 IDNNTKKKI FV++KRL TL+E IDESQLPD+YGGKM L+P+H Sbjct: 226 IDNNTKKKITFVENKRLTETLLEDIDESQLPDIYGGKMPLVPIH 269 >AFK49285.1 unknown [Lotus japonicus] Length = 110 Score = 71.2 bits (173), Expect = 8e-13 Identities = 30/45 (66%), Positives = 42/45 (93%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVHN 135 ID+NTKKKIVFVD+K+L+STL+E IDESQLP++YGG++ L+P+ + Sbjct: 65 IDDNTKKKIVFVDNKKLKSTLLEEIDESQLPEIYGGQLPLVPIQD 109 >XP_012856601.1 PREDICTED: random slug protein 5-like [Erythranthe guttata] EYU21760.1 hypothetical protein MIMGU_mgv1a011582mg [Erythranthe guttata] Length = 277 Score = 74.3 bits (181), Expect = 1e-12 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVHN 135 ID NT+KKIVFV++KRLR TL+E IDESQLPD+YGGK+ L+PV N Sbjct: 232 IDKNTRKKIVFVENKRLRETLLEDIDESQLPDIYGGKLQLVPVQN 276 >XP_006341468.1 PREDICTED: random slug protein 5 [Solanum tuberosum] Length = 271 Score = 73.9 bits (180), Expect = 2e-12 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVH 132 IDNNTKKKI FV++KRL TL++ IDESQLPD+YGGKM L+P+H Sbjct: 226 IDNNTKKKITFVENKRLTETLLQDIDESQLPDIYGGKMPLVPIH 269 >XP_006373203.1 hypothetical protein POPTR_0017s09620g [Populus trichocarpa] ERP51000.1 hypothetical protein POPTR_0017s09620g [Populus trichocarpa] Length = 278 Score = 73.9 bits (180), Expect = 2e-12 Identities = 31/44 (70%), Positives = 41/44 (93%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVH 132 ID NT+KKIVFVD+++L+STL+E IDESQ+PD+YGGK+ LIP+H Sbjct: 232 IDKNTRKKIVFVDNRKLKSTLLEEIDESQIPDIYGGKLPLIPIH 275 >KHN09704.1 Random slug protein 5 [Glycine soja] Length = 265 Score = 72.8 bits (177), Expect = 4e-12 Identities = 31/45 (68%), Positives = 42/45 (93%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVHN 135 ID+NTKKKIVFV++K+L+STL+E I+ESQLPD+YGG+M L+P+ N Sbjct: 220 IDDNTKKKIVFVENKKLKSTLLEEIEESQLPDIYGGQMPLVPIQN 264 >NP_001241473.1 uncharacterized protein LOC100797666 [Glycine max] ACU22859.1 unknown [Glycine max] ACU23015.1 unknown [Glycine max] KRH54081.1 hypothetical protein GLYMA_06G163500 [Glycine max] Length = 265 Score = 72.8 bits (177), Expect = 4e-12 Identities = 31/45 (68%), Positives = 42/45 (93%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVHN 135 ID+NTKKKIVFV++K+L+STL+E I+ESQLPD+YGG+M L+P+ N Sbjct: 220 IDDNTKKKIVFVENKKLKSTLLEEIEESQLPDIYGGQMPLVPIQN 264 >XP_016171582.1 PREDICTED: random slug protein 5-like [Arachis ipaensis] Length = 277 Score = 72.8 bits (177), Expect = 4e-12 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVHN 135 IDNNTKKKIVFVD+K++ TL+E IDESQLP++YGGK+ L+P+ N Sbjct: 232 IDNNTKKKIVFVDNKKITRTLLEEIDESQLPEIYGGKLPLVPIEN 276 >XP_015937934.1 PREDICTED: random slug protein 5-like [Arachis duranensis] Length = 277 Score = 72.8 bits (177), Expect = 4e-12 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVHN 135 IDNNTKKKIVFVD+K++ TL+E IDESQLP++YGGK+ L+P+ N Sbjct: 232 IDNNTKKKIVFVDNKKITRTLLEEIDESQLPEIYGGKLPLVPIEN 276 >XP_009803039.1 PREDICTED: random slug protein 5-like [Nicotiana sylvestris] XP_016503826.1 PREDICTED: random slug protein 5-like [Nicotiana tabacum] Length = 272 Score = 72.4 bits (176), Expect = 6e-12 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVH 132 IDN TKKKI FV+DKRL +TL++ IDESQLP++YGGKM L+P+H Sbjct: 227 IDNKTKKKITFVEDKRLMTTLLQDIDESQLPEIYGGKMPLVPIH 270 >XP_004501761.1 PREDICTED: random slug protein 5-like [Cicer arietinum] Length = 268 Score = 72.0 bits (175), Expect = 7e-12 Identities = 30/45 (66%), Positives = 42/45 (93%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVHN 135 ID+NTK+KIVFVD+K+L+STL+E IDESQ+P++YGG++ L+PV N Sbjct: 223 IDDNTKRKIVFVDNKKLKSTLLEEIDESQIPEIYGGQLQLVPVQN 267 >KDO57636.1 hypothetical protein CISIN_1g043459mg [Citrus sinensis] Length = 243 Score = 71.6 bits (174), Expect = 8e-12 Identities = 30/43 (69%), Positives = 40/43 (93%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPV 129 IDNNTKKKIVFV DK+L+STL+E IDESQ+P++YGG++ L+P+ Sbjct: 198 IDNNTKKKIVFVQDKKLKSTLLEEIDESQIPEIYGGQLPLVPI 240 >XP_015387701.1 PREDICTED: CRAL-TRIO domain-containing protein YKL091C-like isoform X2 [Citrus sinensis] Length = 246 Score = 71.6 bits (174), Expect = 8e-12 Identities = 30/43 (69%), Positives = 40/43 (93%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPV 129 IDNNTKKKIVFV DK+L+STL+E IDESQ+P++YGG++ L+P+ Sbjct: 201 IDNNTKKKIVFVQDKKLKSTLLEEIDESQIPEIYGGQLPLVPI 243 >XP_006436972.1 hypothetical protein CICLE_v10032562mg [Citrus clementina] ESR50212.1 hypothetical protein CICLE_v10032562mg [Citrus clementina] Length = 246 Score = 71.6 bits (174), Expect = 8e-12 Identities = 30/43 (69%), Positives = 40/43 (93%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPV 129 IDNNTKKKIVFV DK+L+STL+E IDESQ+P++YGG++ L+P+ Sbjct: 201 IDNNTKKKIVFVQDKKLKSTLLEEIDESQIPEIYGGQLPLVPI 243 >XP_006485074.1 PREDICTED: CRAL-TRIO domain-containing protein YKL091C-like isoform X1 [Citrus sinensis] XP_015387700.1 PREDICTED: CRAL-TRIO domain-containing protein YKL091C-like isoform X1 [Citrus sinensis] Length = 247 Score = 71.6 bits (174), Expect = 8e-12 Identities = 30/43 (69%), Positives = 40/43 (93%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPV 129 IDNNTKKKIVFV DK+L+STL+E IDESQ+P++YGG++ L+P+ Sbjct: 202 IDNNTKKKIVFVQDKKLKSTLLEEIDESQIPEIYGGQLPLVPI 244 >XP_016578402.1 PREDICTED: random slug protein 5-like [Capsicum annuum] Length = 277 Score = 72.0 bits (175), Expect = 8e-12 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVHN 135 IDNNTKKKI+FVD+KRL +TL++ IDESQLP+ YGGKM L+P+ + Sbjct: 232 IDNNTKKKIIFVDNKRLTATLLQDIDESQLPETYGGKMQLVPIQD 276 >XP_011073289.1 PREDICTED: random slug protein 5-like [Sesamum indicum] Length = 253 Score = 71.6 bits (174), Expect = 9e-12 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVHN 135 ID NT+KKIVFV++KRL +TL+E IDESQLP+VYGGK+ LIP+ N Sbjct: 208 IDKNTRKKIVFVENKRLHATLLEDIDESQLPEVYGGKLELIPIQN 252 >XP_017406154.1 PREDICTED: random slug protein 5-like [Vigna angularis] KOM26061.1 hypothetical protein LR48_Vigan221s002300 [Vigna angularis] BAU03061.1 hypothetical protein VIGAN_UM006500 [Vigna angularis var. angularis] Length = 263 Score = 71.6 bits (174), Expect = 1e-11 Identities = 30/45 (66%), Positives = 43/45 (95%) Frame = +1 Query: 1 IDNNTKKKIVFVDDKRLRSTLIEAIDESQLPDVYGGKMSLIPVHN 135 ID+NTKKKIVFV++K+L+STL+E I+ESQLPD+YGG+M+L+P+ + Sbjct: 218 IDDNTKKKIVFVENKKLKSTLLEEIEESQLPDIYGGQMALVPIQD 262