BLASTX nr result
ID: Lithospermum23_contig00044260
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00044260 (398 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011655830.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-07 KGN52179.1 hypothetical protein Csa_5G613570 [Cucumis sativus] 58 3e-07 XP_004135367.2 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-07 XP_015058177.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 5e-07 XP_019261754.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 1e-06 XP_009762336.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 1e-06 XP_019261753.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 1e-06 KHN12616.1 Pentatricopeptide repeat-containing protein, chloropl... 56 1e-06 XP_003535211.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 1e-06 XP_004308615.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 1e-06 XP_010094357.1 Pentatricopeptide repeat-containing protein [Moru... 56 1e-06 XP_008446749.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 56 1e-06 XP_016650321.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 2e-06 ONI21523.1 hypothetical protein PRUPE_2G071400 [Prunus persica] 55 3e-06 ONI21522.1 hypothetical protein PRUPE_2G071400 [Prunus persica] 55 3e-06 ONI21521.1 hypothetical protein PRUPE_2G071400 [Prunus persica] 55 3e-06 XP_008231812.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 3e-06 XP_019181842.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 5e-06 XP_016450332.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 6e-06 XP_007214817.1 hypothetical protein PRUPE_ppa018727m2g, partial ... 53 7e-06 >XP_011655830.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic isoform X2 [Cucumis sativus] Length = 677 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 Q+ATKTIEEMK GVKPN+KTYTTLINGWA Sbjct: 498 QRATKTIEEMKSVGVKPNVKTYTTLINGWA 527 >KGN52179.1 hypothetical protein Csa_5G613570 [Cucumis sativus] Length = 943 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 Q+ATKTIEEMK GVKPN+KTYTTLINGWA Sbjct: 764 QRATKTIEEMKSVGVKPNVKTYTTLINGWA 793 >XP_004135367.2 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic isoform X1 [Cucumis sativus] Length = 962 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 Q+ATKTIEEMK GVKPN+KTYTTLINGWA Sbjct: 783 QRATKTIEEMKSVGVKPNVKTYTTLINGWA 812 >XP_015058177.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic-like [Solanum pennellii] Length = 932 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 QKAT TI EMKRFGVKPN+KTYTTLI+GWA Sbjct: 764 QKATNTILEMKRFGVKPNVKTYTTLIHGWA 793 >XP_019261754.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic isoform X2 [Nicotiana attenuata] Length = 640 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 QKAT TI+EMKR GVKPN+KTYTTLI+GWA Sbjct: 467 QKATNTIQEMKRVGVKPNVKTYTTLIHGWA 496 >XP_009762336.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic [Nicotiana sylvestris] Length = 800 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 QKAT TI+EMKR GVKPN+KTYTTLI+GWA Sbjct: 629 QKATNTIQEMKRVGVKPNVKTYTTLIHGWA 658 >XP_019261753.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic isoform X1 [Nicotiana attenuata] OIT38285.1 pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 952 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 QKAT TI+EMKR GVKPN+KTYTTLI+GWA Sbjct: 779 QKATNTIQEMKRVGVKPNVKTYTTLIHGWA 808 >KHN12616.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 731 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 QKAT+ I+EM+ FG+KPNLKTYTTLINGWA Sbjct: 560 QKATEIIQEMEAFGIKPNLKTYTTLINGWA 589 >XP_003535211.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic-like [Glycine max] KRH33421.1 hypothetical protein GLYMA_10G122100 [Glycine max] Length = 918 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 QKAT+ I+EM+ FG+KPNLKTYTTLINGWA Sbjct: 746 QKATEIIQEMEAFGIKPNLKTYTTLINGWA 775 >XP_004308615.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic [Fragaria vesca subsp. vesca] Length = 924 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 Q+A KTI+EMK FGVKPN+KTYTTLI+GWA Sbjct: 748 QRAAKTIDEMKTFGVKPNIKTYTTLIHGWA 777 >XP_010094357.1 Pentatricopeptide repeat-containing protein [Morus notabilis] EXB55868.1 Pentatricopeptide repeat-containing protein [Morus notabilis] Length = 946 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +3 Query: 312 KATKTIEEMKRFGVKPNLKTYTTLINGWA 398 +ATKTI+EM+ FGVKPN+KTYTTLINGWA Sbjct: 776 RATKTIQEMQTFGVKPNVKTYTTLINGWA 804 >XP_008446749.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g04810, chloroplastic [Cucumis melo] Length = 982 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 Q+ATKTIEEMK GVKPN+KTYTTLI+GWA Sbjct: 803 QRATKTIEEMKSVGVKPNVKTYTTLIHGWA 832 >XP_016650321.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic isoform X2 [Prunus mume] Length = 636 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 Q+A KTIEEM+ FGVKPN+KTYTTLI+GWA Sbjct: 467 QRAAKTIEEMEAFGVKPNVKTYTTLIHGWA 496 >ONI21523.1 hypothetical protein PRUPE_2G071400 [Prunus persica] Length = 923 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 Q+A KTIEEM+ FGVKPN+KTYTTLI+GWA Sbjct: 754 QRAAKTIEEMEAFGVKPNVKTYTTLIHGWA 783 >ONI21522.1 hypothetical protein PRUPE_2G071400 [Prunus persica] Length = 932 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 Q+A KTIEEM+ FGVKPN+KTYTTLI+GWA Sbjct: 763 QRAAKTIEEMEAFGVKPNVKTYTTLIHGWA 792 >ONI21521.1 hypothetical protein PRUPE_2G071400 [Prunus persica] Length = 952 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 Q+A KTIEEM+ FGVKPN+KTYTTLI+GWA Sbjct: 783 QRAAKTIEEMEAFGVKPNVKTYTTLIHGWA 812 >XP_008231812.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic isoform X1 [Prunus mume] Length = 953 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 Q+A KTIEEM+ FGVKPN+KTYTTLI+GWA Sbjct: 784 QRAAKTIEEMEAFGVKPNVKTYTTLIHGWA 813 >XP_019181842.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic-like [Ipomoea nil] Length = 890 Score = 54.7 bits (130), Expect = 5e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 Q+ATKTIEEMK GV+PN+K+YTTLINGWA Sbjct: 738 QRATKTIEEMKLVGVQPNVKSYTTLINGWA 767 >XP_016450332.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic [Nicotiana tabacum] Length = 946 Score = 54.3 bits (129), Expect = 6e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 309 QKATKTIEEMKRFGVKPNLKTYTTLINGWA 398 QKA TI+EMKR GVKPN+KTYTTLI+GWA Sbjct: 773 QKAMNTIQEMKRVGVKPNVKTYTTLIHGWA 802 >XP_007214817.1 hypothetical protein PRUPE_ppa018727m2g, partial [Prunus persica] Length = 168 Score = 52.8 bits (125), Expect = 7e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 315 ATKTIEEMKRFGVKPNLKTYTTLINGWA 398 A KTIEEM+ FGVKPN+KTYTTLI+GWA Sbjct: 1 AAKTIEEMEAFGVKPNVKTYTTLIHGWA 28