BLASTX nr result
ID: Lithospermum23_contig00044214
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00044214 (319 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB09803.1 hypothetical protein B456_001G167900 [Gossypium raimo... 89 1e-20 >KJB09803.1 hypothetical protein B456_001G167900 [Gossypium raimondii] Length = 108 Score = 88.6 bits (218), Expect = 1e-20 Identities = 41/55 (74%), Positives = 45/55 (81%) Frame = +3 Query: 36 NIFIPNEHQSAFYSLAFTDWLCSNASCKDLQFGFDFQWRTTFCAIAWKILVWSGG 200 +I +P+ H SLAFTDWLCSNA CKDL+FGFD QWRTTF AIAWKILVWSGG Sbjct: 20 SIKVPSTH-----SLAFTDWLCSNAFCKDLKFGFDCQWRTTFYAIAWKILVWSGG 69