BLASTX nr result
ID: Lithospermum23_contig00044089
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00044089 (205 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019231213.1 PREDICTED: teosinte glume architecture 1-like [Ni... 54 6e-07 CDP13362.1 unnamed protein product [Coffea canephora] 54 8e-07 XP_019180911.1 PREDICTED: squamosa promoter-binding-like protein... 53 2e-06 XP_019180910.1 PREDICTED: squamosa promoter-binding-like protein... 53 2e-06 >XP_019231213.1 PREDICTED: teosinte glume architecture 1-like [Nicotiana attenuata] XP_019231214.1 PREDICTED: teosinte glume architecture 1-like [Nicotiana attenuata] XP_019231215.1 PREDICTED: teosinte glume architecture 1-like [Nicotiana attenuata] XP_019231216.1 PREDICTED: teosinte glume architecture 1-like [Nicotiana attenuata] XP_019231218.1 PREDICTED: teosinte glume architecture 1-like [Nicotiana attenuata] OIT28908.1 squamosa promoter-binding-like protein 16 [Nicotiana attenuata] Length = 327 Score = 54.3 bits (129), Expect = 6e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 94 MESTTLSGSSKRAKAPGSVAQAAQCLVDGCN 2 MES++ SGSSKRAKAPG++AQ A CLVDGCN Sbjct: 1 MESSSSSGSSKRAKAPGNIAQVAHCLVDGCN 31 >CDP13362.1 unnamed protein product [Coffea canephora] Length = 323 Score = 53.9 bits (128), Expect = 8e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 94 MESTTLSGSSKRAKAPGSVAQAAQCLVDGCN 2 MES++L+GSSKRAKAPG+V Q A CLVDGCN Sbjct: 1 MESSSLTGSSKRAKAPGNVTQMAHCLVDGCN 31 >XP_019180911.1 PREDICTED: squamosa promoter-binding-like protein 13A isoform X2 [Ipomoea nil] Length = 310 Score = 52.8 bits (125), Expect = 2e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 88 STTLSGSSKRAKAPGSVAQAAQCLVDGCN 2 S++LSGSSKRAKAPGSV Q A CLVDGCN Sbjct: 4 SSSLSGSSKRAKAPGSVGQVAHCLVDGCN 32 >XP_019180910.1 PREDICTED: squamosa promoter-binding-like protein 13A isoform X1 [Ipomoea nil] Length = 315 Score = 52.8 bits (125), Expect = 2e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 88 STTLSGSSKRAKAPGSVAQAAQCLVDGCN 2 S++LSGSSKRAKAPGSV Q A CLVDGCN Sbjct: 4 SSSLSGSSKRAKAPGSVGQVAHCLVDGCN 32