BLASTX nr result
ID: Lithospermum23_contig00043703
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00043703 (340 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002457951.1 hypothetical protein SORBIDRAFT_03g023051, partia... 55 1e-06 >XP_002457951.1 hypothetical protein SORBIDRAFT_03g023051, partial [Sorghum bicolor] Length = 979 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/64 (39%), Positives = 42/64 (65%) Frame = +3 Query: 138 PRKMSSEVPQATPKIPQSVAATFTDEDMPEVDGDHNQPIHISGYLCDVKISRMLVDEGSA 317 P EV QA K+PQ+ + TF DED+ + HN+P+ + G + D+ ++R+++D GSA Sbjct: 888 PEDYRVEVSQAEVKLPQTQSITFNDEDLLLGNKKHNRPLFMFGEIDDLPVNRIMIDGGSA 947 Query: 318 VNIL 329 +N+L Sbjct: 948 INLL 951