BLASTX nr result
ID: Lithospermum23_contig00043634
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00043634 (357 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016447481.1 PREDICTED: RNA-binding protein 39-like [Nicotiana... 53 3e-06 XP_018718257.1 PREDICTED: LOW QUALITY PROTEIN: RNA-binding prote... 54 7e-06 >XP_016447481.1 PREDICTED: RNA-binding protein 39-like [Nicotiana tabacum] Length = 144 Score = 52.8 bits (125), Expect = 3e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = +3 Query: 285 QIFEAFGPVELIQLPLDPETGHCK 356 QIFEAFGPVEL+QLP DPETGHCK Sbjct: 8 QIFEAFGPVELVQLPTDPETGHCK 31 >XP_018718257.1 PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 39 [Eucalyptus grandis] Length = 573 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +3 Query: 252 NISWRLFMSDLQ-IFEAFGPVELIQLPLDPETGHCK 356 N+ + + S L+ IFEAFGPVEL+QLPLDPETGHCK Sbjct: 319 NLHFNMTESHLKSIFEAFGPVELVQLPLDPETGHCK 354