BLASTX nr result
ID: Lithospermum23_contig00043556
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00043556 (557 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK66771.1 phytoene synthase [Osmanthus fragrans] 95 2e-19 BAS69427.1 phytoene synthase [Rhododendron japonicum f. flavum] 94 3e-19 APB08593.1 phytoene synthase [Rhododendron molle] 94 3e-19 AET07434.1 phytoene synthase, partial [Ipomoea batatas] 87 7e-19 XP_016447683.1 PREDICTED: phytoene synthase 2, chloroplastic-lik... 92 9e-19 AJB84620.1 phytoene synthase [Camellia sinensis] 92 1e-18 BAS69577.1 phytoene synthase [Rhododendron kiusianum x Rhododend... 92 1e-18 BAS69428.1 phytoene synthase [Rhododendron kiusianum x Rhododend... 92 1e-18 XP_011096926.1 PREDICTED: phytoene synthase 2, chloroplastic [Se... 92 1e-18 XP_009770434.1 PREDICTED: phytoene synthase 2, chloroplastic [Ni... 92 1e-18 AHA58684.1 phytoene synthase [Nicotiana tabacum] 92 1e-18 ADZ24219.1 phytoene synthase 1 [Nicotiana tabacum] 92 1e-18 NP_001312069.1 phytoene synthase 2, chloroplastic-like [Nicotian... 92 1e-18 XP_019265202.1 PREDICTED: phytoene synthase 2, chloroplastic [Ni... 92 2e-18 AAX33349.1 phytoene synthase 1, partial [Prunus armeniaca] 89 2e-18 XP_012841552.1 PREDICTED: phytoene synthase 2, chloroplastic [Er... 92 2e-18 ALE33743.1 phytoene synthase 1 [Erythranthe lewisii] 92 2e-18 XP_018816875.1 PREDICTED: phytoene synthase 2, chloroplastic [Ju... 92 2e-18 ACO53104.1 phytoene synthase [Actinidia deliciosa] 92 2e-18 AHJ90431.1 phytoene synthase [Pogostemon cablin] 92 2e-18 >AFK66771.1 phytoene synthase [Osmanthus fragrans] Length = 438 Score = 94.7 bits (234), Expect = 2e-19 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSSSRMKA 397 LYRQILDEIE NDYNNFTRRAYV+KPKKILALP+AYAKSLVPPSR SS +KA Sbjct: 386 LYRQILDEIEVNDYNNFTRRAYVNKPKKILALPIAYAKSLVPPSRASSPFVKA 438 >BAS69427.1 phytoene synthase [Rhododendron japonicum f. flavum] Length = 431 Score = 94.0 bits (232), Expect = 3e-19 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSS 412 LYRQILDEIEANDYNNFTRRAYVSKPKK+LALPVAYAKSLV PSRTSS Sbjct: 380 LYRQILDEIEANDYNNFTRRAYVSKPKKVLALPVAYAKSLVSPSRTSS 427 >APB08593.1 phytoene synthase [Rhododendron molle] Length = 432 Score = 94.0 bits (232), Expect = 3e-19 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSS 412 LYRQILDEIEANDYNNFTRRAYVSKPKK+LALPVAYAKSLV PSRTSS Sbjct: 381 LYRQILDEIEANDYNNFTRRAYVSKPKKVLALPVAYAKSLVSPSRTSS 428 >AET07434.1 phytoene synthase, partial [Ipomoea batatas] Length = 117 Score = 87.0 bits (214), Expect = 7e-19 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSSSRMKA 397 LYR+ILDEIEANDYNNFTRRAYVSKPKK+LALP+AYAK+++ PS T+S KA Sbjct: 65 LYRKILDEIEANDYNNFTRRAYVSKPKKLLALPIAYAKAVIRPSTTASPLAKA 117 >XP_016447683.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Nicotiana tabacum] Length = 412 Score = 92.4 bits (228), Expect = 9e-19 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSSSRMK 400 LYR+ILDEIEANDYNNFTRRAYVSKPKK+L LP+AYAKSLVPP+RTSS K Sbjct: 360 LYRKILDEIEANDYNNFTRRAYVSKPKKLLTLPIAYAKSLVPPNRTSSPLAK 411 >AJB84620.1 phytoene synthase [Camellia sinensis] Length = 422 Score = 92.4 bits (228), Expect = 1e-18 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTS 415 LYRQILDEIEANDYNNFTRRAYVSKPKKI+ALPVAYAKSLVPPSR S Sbjct: 369 LYRQILDEIEANDYNNFTRRAYVSKPKKIVALPVAYAKSLVPPSRLS 415 >BAS69577.1 phytoene synthase [Rhododendron kiusianum x Rhododendron indicum] Length = 432 Score = 92.4 bits (228), Expect = 1e-18 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSS 412 LYRQILDEIEANDYNNFTRRAYVSKPKK+ ALPVAYAKSLV PSRTSS Sbjct: 381 LYRQILDEIEANDYNNFTRRAYVSKPKKVFALPVAYAKSLVSPSRTSS 428 >BAS69428.1 phytoene synthase [Rhododendron kiusianum x Rhododendron indicum] Length = 432 Score = 92.4 bits (228), Expect = 1e-18 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSS 412 LYRQILDEIEANDYNNFTRRAYVSKPKK+ ALPVAYAKSLV PSRTSS Sbjct: 381 LYRQILDEIEANDYNNFTRRAYVSKPKKVFALPVAYAKSLVSPSRTSS 428 >XP_011096926.1 PREDICTED: phytoene synthase 2, chloroplastic [Sesamum indicum] XP_011096927.1 PREDICTED: phytoene synthase 2, chloroplastic [Sesamum indicum] Length = 439 Score = 92.4 bits (228), Expect = 1e-18 Identities = 48/54 (88%), Positives = 50/54 (92%), Gaps = 1/54 (1%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLV-PPSRTSSSRMKA 397 LYRQILDEIEANDYNNFTRRAYV KPKKILALP+AYAKSLV PPSRTSS +KA Sbjct: 386 LYRQILDEIEANDYNNFTRRAYVGKPKKILALPLAYAKSLVPPPSRTSSPVVKA 439 >XP_009770434.1 PREDICTED: phytoene synthase 2, chloroplastic [Nicotiana sylvestris] XP_009770435.1 PREDICTED: phytoene synthase 2, chloroplastic [Nicotiana sylvestris] XP_016435460.1 PREDICTED: phytoene synthase 2, chloroplastic [Nicotiana tabacum] XP_016435461.1 PREDICTED: phytoene synthase 2, chloroplastic [Nicotiana tabacum] Length = 440 Score = 92.4 bits (228), Expect = 1e-18 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSSSRMK 400 LYR+ILDEIEANDYNNFTRRAYVSKPKK+L LP+AYAKSLVPP+RTSS K Sbjct: 388 LYRKILDEIEANDYNNFTRRAYVSKPKKLLTLPIAYAKSLVPPNRTSSPLAK 439 >AHA58684.1 phytoene synthase [Nicotiana tabacum] Length = 440 Score = 92.4 bits (228), Expect = 1e-18 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSSSRMK 400 LYR+ILDEIEANDYNNFTRRAYVSKPKK+L LP+AYAKSLVPP+RTSS K Sbjct: 388 LYRKILDEIEANDYNNFTRRAYVSKPKKLLTLPIAYAKSLVPPNRTSSPLAK 439 >ADZ24219.1 phytoene synthase 1 [Nicotiana tabacum] Length = 440 Score = 92.4 bits (228), Expect = 1e-18 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSSSRMK 400 LYR+ILDEIEANDYNNFTRRAYVSKPKK+L LP+AYAKSLVPP+RTSS K Sbjct: 388 LYRKILDEIEANDYNNFTRRAYVSKPKKLLTLPIAYAKSLVPPNRTSSPLAK 439 >NP_001312069.1 phytoene synthase 2, chloroplastic-like [Nicotiana tabacum] XP_009631632.1 PREDICTED: phytoene synthase 2, chloroplastic [Nicotiana tomentosiformis] XP_009631633.1 PREDICTED: phytoene synthase 2, chloroplastic [Nicotiana tomentosiformis] XP_018622117.1 PREDICTED: phytoene synthase 2, chloroplastic [Nicotiana tomentosiformis] ADK25054.1 phytoene synthase [Nicotiana tabacum] Length = 441 Score = 92.4 bits (228), Expect = 1e-18 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSSSRMK 400 LYR+ILDEIEANDYNNFTRRAYVSKPKK+L LP+AYAKSLVPP+RTSS K Sbjct: 389 LYRKILDEIEANDYNNFTRRAYVSKPKKLLTLPIAYAKSLVPPNRTSSPLAK 440 >XP_019265202.1 PREDICTED: phytoene synthase 2, chloroplastic [Nicotiana attenuata] OIT35874.1 bifunctional 15-cis-phytoene synthase, chromoplastic [Nicotiana attenuata] Length = 440 Score = 92.0 bits (227), Expect = 2e-18 Identities = 43/48 (89%), Positives = 47/48 (97%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSS 412 LYR+ILDEIEANDYNNFTRRAYVSKPKK+L LP+AYAKSLVPP+RTSS Sbjct: 388 LYRKILDEIEANDYNNFTRRAYVSKPKKLLTLPIAYAKSLVPPNRTSS 435 >AAX33349.1 phytoene synthase 1, partial [Prunus armeniaca] Length = 211 Score = 88.6 bits (218), Expect = 2e-18 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSSSRMKA 397 LYRQILDEIEANDYNNFTRRAYVSK KK+LALP+AY KSL+ PSRTSS +A Sbjct: 149 LYRQILDEIEANDYNNFTRRAYVSKAKKLLALPIAYTKSLIRPSRTSSYSTRA 201 >XP_012841552.1 PREDICTED: phytoene synthase 2, chloroplastic [Erythranthe guttata] XP_012841553.1 PREDICTED: phytoene synthase 2, chloroplastic [Erythranthe guttata] EYU33952.1 hypothetical protein MIMGU_mgv1a007168mg [Erythranthe guttata] Length = 416 Score = 91.7 bits (226), Expect = 2e-18 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSSSRM 403 LYRQILDEIEANDYNNFTRRAYVSKPKKILALP+AYAKSLVPPS SS + Sbjct: 363 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPLAYAKSLVPPSSKPSSTL 413 >ALE33743.1 phytoene synthase 1 [Erythranthe lewisii] Length = 417 Score = 91.7 bits (226), Expect = 2e-18 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSSSRM 403 LYRQILDEIEANDYNNFTRRAYVSKPKKILALP+AYAKSLVPPS SS + Sbjct: 364 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPLAYAKSLVPPSSKPSSTL 414 >XP_018816875.1 PREDICTED: phytoene synthase 2, chloroplastic [Juglans regia] Length = 435 Score = 91.7 bits (226), Expect = 2e-18 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSSSRMKA 397 LYRQILDEIEANDYNNFT+RAYVSK KK+LALP+AY KSLVPPSRTSS KA Sbjct: 383 LYRQILDEIEANDYNNFTQRAYVSKAKKLLALPIAYTKSLVPPSRTSSLLTKA 435 >ACO53104.1 phytoene synthase [Actinidia deliciosa] Length = 437 Score = 91.7 bits (226), Expect = 2e-18 Identities = 43/48 (89%), Positives = 47/48 (97%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPPSRTSS 412 LYRQILDEIEANDYNNFTRRAYVSKPKK+LALP+AYAKS+V P+RTSS Sbjct: 384 LYRQILDEIEANDYNNFTRRAYVSKPKKVLALPIAYAKSIVAPTRTSS 431 >AHJ90431.1 phytoene synthase [Pogostemon cablin] Length = 439 Score = 91.7 bits (226), Expect = 2e-18 Identities = 46/53 (86%), Positives = 50/53 (94%), Gaps = 1/53 (1%) Frame = -3 Query: 555 LYRQILDEIEANDYNNFTRRAYVSKPKKILALPVAYAKSLVPP-SRTSSSRMK 400 LYRQILDEIEANDYNNFTRRAYVSKPKKI+ALP+AYAKSLVPP S+ SSS +K Sbjct: 386 LYRQILDEIEANDYNNFTRRAYVSKPKKIIALPIAYAKSLVPPLSKASSSLVK 438