BLASTX nr result
ID: Lithospermum23_contig00043329
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00043329 (308 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018823974.1 PREDICTED: zinc finger BED domain-containing prot... 60 2e-08 XP_017242249.1 PREDICTED: zinc finger BED domain-containing prot... 59 2e-08 XP_018846140.1 PREDICTED: zinc finger BED domain-containing prot... 60 2e-08 XP_017250805.1 PREDICTED: zinc finger BED domain-containing prot... 59 5e-08 XP_017229715.1 PREDICTED: zinc finger BED domain-containing prot... 58 1e-07 XP_017229714.1 PREDICTED: zinc finger BED domain-containing prot... 58 1e-07 XP_018853162.1 PREDICTED: zinc finger BED domain-containing prot... 58 1e-07 XP_018844929.1 PREDICTED: zinc finger BED domain-containing prot... 58 1e-07 XP_018809264.1 PREDICTED: zinc finger BED domain-containing prot... 58 1e-07 XP_017250905.1 PREDICTED: zinc finger BED domain-containing prot... 53 6e-06 XP_017228466.1 PREDICTED: zinc finger BED domain-containing prot... 53 6e-06 XP_018857101.1 PREDICTED: uncharacterized protein LOC109019286 [... 52 6e-06 KZV49208.1 zinc finger BED domain-containing protein RICESLEEPER... 53 8e-06 KZV35483.1 zinc finger BED domain-containing protein RICESLEEPER... 50 9e-06 >XP_018823974.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Juglans regia] Length = 428 Score = 60.5 bits (145), Expect = 2e-08 Identities = 30/64 (46%), Positives = 41/64 (64%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRARRKEQMLYVY*IFLSFFYFLML 50 SAG R+IDP +AS+ TV+MLLCGS+WV+ LYG+KR+ M Y I L + + L Sbjct: 363 SAGGRVIDPHRASLSTETVQMLLCGSDWVRALYGLKRSSTNSCMPIEYCILLPAGWQIRL 422 Query: 49 HTYV 38 +V Sbjct: 423 FLWV 426 >XP_017242249.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Daucus carota subsp. sativus] Length = 200 Score = 58.9 bits (141), Expect = 2e-08 Identities = 22/43 (51%), Positives = 38/43 (88%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRARRKEQ 101 SAG R+I+P ++ +K TV++LLCG++WV+ELYG+K+A+++E+ Sbjct: 150 SAGSRVIEPHRSCLKPETVEVLLCGADWVRELYGLKKAKQEEE 192 >XP_018846140.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Juglans regia] Length = 484 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/60 (46%), Positives = 40/60 (66%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRARRKEQMLYVY*IFLSFFYFLML 50 SAG R+IDP +AS+ TV+MLLCGS+WV+ LYG+KR+ + V + L F ++L Sbjct: 414 SAGGRVIDPHRASLSTETVQMLLCGSDWVRALYGLKRSSTNSLSVLVVLLILLIFDSIVL 473 >XP_017250805.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Daucus carota subsp. sativus] Length = 643 Score = 58.9 bits (141), Expect = 5e-08 Identities = 21/48 (43%), Positives = 40/48 (83%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRARRKEQMLYVY 86 SAG R+I+P ++ +K TV+MLLCG++WV+ELYG+K+++ +++ + ++ Sbjct: 557 SAGSRVIEPHRSCLKPETVEMLLCGADWVRELYGLKKSKEEDKEIVIH 604 >XP_017229715.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X2 [Daucus carota subsp. sativus] Length = 443 Score = 58.2 bits (139), Expect = 1e-07 Identities = 22/42 (52%), Positives = 37/42 (88%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRARRKE 104 SAG R+I+P ++ +K TV++LLCG++WV+ELYG+K+A+++E Sbjct: 393 SAGSRVIEPHRSCLKPETVEVLLCGADWVRELYGLKKAKQEE 434 >XP_017229714.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X1 [Daucus carota subsp. sativus] Length = 715 Score = 58.2 bits (139), Expect = 1e-07 Identities = 22/42 (52%), Positives = 37/42 (88%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRARRKE 104 SAG R+I+P ++ +K TV++LLCG++WV+ELYG+K+A+++E Sbjct: 665 SAGSRVIEPHRSCLKPETVEVLLCGADWVRELYGLKKAKQEE 706 >XP_018853162.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like, partial [Juglans regia] Length = 378 Score = 57.8 bits (138), Expect = 1e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRA 116 SAG R+IDP +AS+ TV+MLLCGS+WV+ LYG+KR+ Sbjct: 322 SAGGRVIDPHRASLSTETVQMLLCGSDWVRALYGLKRS 359 >XP_018844929.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Juglans regia] Length = 402 Score = 57.8 bits (138), Expect = 1e-07 Identities = 27/60 (45%), Positives = 39/60 (65%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRARRKEQMLYVY*IFLSFFYFLML 50 SAG R+IDP +AS+ V+MLLCGS+WV+ LYG+KR+ + V + L F ++L Sbjct: 332 SAGGRVIDPHRASLSTEIVQMLLCGSDWVRALYGLKRSSTNSLSVLVVLLILLIFDSIVL 391 >XP_018809264.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like, partial [Juglans regia] Length = 454 Score = 57.8 bits (138), Expect = 1e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRA 116 SAG R+IDP +AS+ TV+MLLCGS+WV+ LYG+KR+ Sbjct: 413 SAGGRVIDPHRASLSTETVQMLLCGSDWVRALYGLKRS 450 >XP_017250905.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Daucus carota subsp. sativus] Length = 453 Score = 53.1 bits (126), Expect = 6e-06 Identities = 22/43 (51%), Positives = 32/43 (74%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRARRKEQ 101 SAG R+I+P + +K TV+MLLCG++W +ELYG+KR + Q Sbjct: 399 SAGSRVIEPHCSCIKPETVEMLLCGADWARELYGLKRTMQGNQ 441 >XP_017228466.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Daucus carota subsp. sativus] Length = 470 Score = 53.1 bits (126), Expect = 6e-06 Identities = 21/43 (48%), Positives = 32/43 (74%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRARRKEQ 101 SAG R+I+P ++ +K V+MLLCG++W +ELYG+KR + Q Sbjct: 416 SAGSRVIEPHRSCLKPEIVEMLLCGADWARELYGLKRTMQGNQ 458 >XP_018857101.1 PREDICTED: uncharacterized protein LOC109019286 [Juglans regia] Length = 154 Score = 51.6 bits (122), Expect = 6e-06 Identities = 21/42 (50%), Positives = 32/42 (76%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRARRKE 104 SAG R+IDP +AS+ TV++LLCG+EWV+ +G+K+ + E Sbjct: 104 SAGGRVIDPYRASLSTETVQILLCGAEWVRARHGVKKELKDE 145 >KZV49208.1 zinc finger BED domain-containing protein RICESLEEPER 1-like [Dorcoceras hygrometricum] Length = 378 Score = 52.8 bits (125), Expect = 8e-06 Identities = 21/48 (43%), Positives = 34/48 (70%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRARRKEQMLYVY 86 SAG R+ID +AS+ STV+ML+CG +W ++ YG+K+ + Q+ +Y Sbjct: 330 SAGSRVIDKYRASLAPSTVEMLMCGGDWCRKRYGVKKKTKVRQLSTIY 377 >KZV35483.1 zinc finger BED domain-containing protein RICESLEEPER 2-like [Dorcoceras hygrometricum] Length = 116 Score = 50.4 bits (119), Expect = 9e-06 Identities = 20/43 (46%), Positives = 32/43 (74%) Frame = -2 Query: 229 SAGKRIIDPKKASMKVSTVKMLLCGSEWVKELYGIKRARRKEQ 101 SAG R+ID +AS+ STV+ML+CG +W ++ YG+K+ + E+ Sbjct: 64 SAGSRVIDKYRASLAPSTVEMLMCGGDWCRKRYGVKKKTKAEK 106