BLASTX nr result
ID: Lithospermum23_contig00043251
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00043251 (209 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010665734.1 PREDICTED: uncharacterized protein LOC104882987 i... 51 8e-06 >XP_010665734.1 PREDICTED: uncharacterized protein LOC104882987 isoform X2 [Beta vulgaris subsp. vulgaris] KMT19003.1 hypothetical protein BVRB_2g030990 [Beta vulgaris subsp. vulgaris] Length = 378 Score = 51.2 bits (121), Expect = 8e-06 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = +2 Query: 20 KNHLYCDYCKMQGHVMKKCFSLNGYPPGNK 109 KN+ YCDYCK GH ++C+ LNGYPP +K Sbjct: 271 KNNYYCDYCKCPGHSTERCYKLNGYPPNHK 300