BLASTX nr result
ID: Lithospermum23_contig00043234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00043234 (325 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAU74353.1 hypothetical protein LE_TR15446_c14_g1_i1_g.48810, pa... 46 6e-06 JAU49119.1 hypothetical protein LC_TR10504_c5_g1_i1_g.36974, par... 46 7e-06 >JAU74353.1 hypothetical protein LE_TR15446_c14_g1_i1_g.48810, partial [Noccaea caerulescens] Length = 1124 Score = 46.2 bits (108), Expect(2) = 6e-06 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = -1 Query: 121 FTYEFYRDTWNVRGSNVCEVVKTFFATSYMPKHVNCTAI 5 F EF++ +W V G V + VK FFATS+MPK +N T++ Sbjct: 374 FPVEFFKASWGVIGKEVIDAVKEFFATSFMPKALNATSL 412 Score = 30.8 bits (68), Expect(2) = 6e-06 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -2 Query: 249 ISQAIKNIIEEADEVALVANFTDEEIGSIAMSLKKEKAPGPDCLPMNF 106 + + I N +A + ++FT E I S + K PGPD P+ F Sbjct: 331 LERVILNHCSDAQRRLMKSDFTSESIISSLSKMPLNKTPGPDGFPVEF 378 >JAU49119.1 hypothetical protein LC_TR10504_c5_g1_i1_g.36974, partial [Noccaea caerulescens] Length = 533 Score = 46.2 bits (108), Expect(2) = 7e-06 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = -1 Query: 121 FTYEFYRDTWNVRGSNVCEVVKTFFATSYMPKHVNCTAI 5 F EF++ +W V G V + VK FFATS+MPK +N T++ Sbjct: 307 FPVEFFKASWGVIGKEVIDAVKEFFATSFMPKALNATSL 345 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -2 Query: 249 ISQAIKNIIEEADEVALVANFTDEEIGSIAMSLKKEKAPGPDCLPMNF 106 + + I N +A + ++FT E I S + K PGPD P+ F Sbjct: 264 LERVILNHCSDAQRRLMKSDFTSESIISSLSKMPLNKTPGPDGFPVEF 311