BLASTX nr result
ID: Lithospermum23_contig00043102
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00043102 (227 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV27583.1 hypothetical protein F511_11586 [Dorcoceras hygrometr... 55 2e-07 CDP04552.1 unnamed protein product [Coffea canephora] 55 5e-07 XP_004486378.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 54 5e-07 XP_011460074.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 54 6e-07 XP_011460073.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 54 6e-07 XP_011460071.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 54 6e-07 XP_004486377.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 54 8e-07 XP_012848832.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 54 1e-06 XP_011095874.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 53 1e-06 KCW76558.1 hypothetical protein EUGRSUZ_D00945 [Eucalyptus grandis] 52 3e-06 XP_014517953.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 52 3e-06 XP_011658103.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 52 4e-06 XP_008440960.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 52 4e-06 KVH88564.1 HRDC-like protein [Cynara cardunculus var. scolymus] 52 4e-06 XP_011658100.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 52 4e-06 XP_008440955.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 52 4e-06 GAU47145.1 hypothetical protein TSUD_379220, partial [Trifolium ... 52 4e-06 BAT87600.1 hypothetical protein VIGAN_05098900 [Vigna angularis ... 51 5e-06 XP_019263003.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 52 5e-06 XP_019263002.1 PREDICTED: DNA-directed RNA polymerases IV and V ... 52 5e-06 >KZV27583.1 hypothetical protein F511_11586 [Dorcoceras hygrometricum] Length = 180 Score = 55.1 bits (131), Expect = 2e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 227 TCLMDCEAAEILQGIQDHMVELSADAEIKIPM 132 TC+MDCEAAEILQGIQD+M+ LS D +IKIP+ Sbjct: 81 TCMMDCEAAEILQGIQDNMITLSQDPDIKIPV 112 >CDP04552.1 unnamed protein product [Coffea canephora] Length = 278 Score = 54.7 bits (130), Expect = 5e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAAEILQGIQD MV +SAD IKIP+ F Sbjct: 164 CLMDCEAAEILQGIQDRMVVISADPSIKIPISF 196 >XP_004486378.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X2 [Cicer arietinum] Length = 193 Score = 53.9 bits (128), Expect = 5e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAA ILQGIQDHMV LS D IKIP+ F Sbjct: 79 CLMDCEAAVILQGIQDHMVMLSRDPSIKIPVSF 111 >XP_011460074.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X3 [Fragaria vesca subsp. vesca] Length = 198 Score = 53.9 bits (128), Expect = 6e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAA+ILQG+QDHMV LS D IK+P+ F Sbjct: 84 CLMDCEAADILQGVQDHMVILSKDPSIKLPVSF 116 >XP_011460073.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X2 [Fragaria vesca subsp. vesca] Length = 201 Score = 53.9 bits (128), Expect = 6e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAA+ILQG+QDHMV LS D IK+P+ F Sbjct: 87 CLMDCEAADILQGVQDHMVILSKDPSIKLPVSF 119 >XP_011460071.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X1 [Fragaria vesca subsp. vesca] XP_011460072.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X1 [Fragaria vesca subsp. vesca] Length = 204 Score = 53.9 bits (128), Expect = 6e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAA+ILQG+QDHMV LS D IK+P+ F Sbjct: 90 CLMDCEAADILQGVQDHMVILSKDPSIKLPVSF 122 >XP_004486377.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X1 [Cicer arietinum] Length = 240 Score = 53.9 bits (128), Expect = 8e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAA ILQGIQDHMV LS D IKIP+ F Sbjct: 126 CLMDCEAAVILQGIQDHMVMLSRDPSIKIPVSF 158 >XP_012848832.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 [Erythranthe guttata] EYU27635.1 hypothetical protein MIMGU_mgv1a013403mg [Erythranthe guttata] Length = 221 Score = 53.5 bits (127), Expect = 1e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAAEILQGIQD MV LS D +IK+P+ F Sbjct: 100 CLMDCEAAEILQGIQDQMVVLSQDPDIKLPVSF 132 >XP_011095874.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 [Sesamum indicum] XP_011095875.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 [Sesamum indicum] Length = 220 Score = 53.1 bits (126), Expect = 1e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAAEILQGIQD MV LS D +IK+P+ F Sbjct: 99 CLMDCEAAEILQGIQDQMVILSQDPDIKLPVSF 131 >KCW76558.1 hypothetical protein EUGRSUZ_D00945 [Eucalyptus grandis] Length = 173 Score = 51.6 bits (122), Expect = 3e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAAEILQGIQ+ MV LS D IKIP+ F Sbjct: 113 CLMDCEAAEILQGIQEQMVVLSEDPTIKIPVSF 145 >XP_014517953.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 [Vigna radiata var. radiata] Length = 211 Score = 52.0 bits (123), Expect = 3e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAA+ILQGIQD MV LS D+ IKIP F Sbjct: 97 CLMDCEAADILQGIQDQMVMLSRDSTIKIPTSF 129 >XP_011658103.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X2 [Cucumis sativus] XP_011658104.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X2 [Cucumis sativus] Length = 216 Score = 52.0 bits (123), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAA++LQGIQD MV LSAD IKIP F Sbjct: 103 CLMDCEAAQLLQGIQDQMVFLSADPTIKIPTSF 135 >XP_008440960.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X2 [Cucumis melo] Length = 216 Score = 52.0 bits (123), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAA++LQGIQD MV LSAD IKIP F Sbjct: 103 CLMDCEAAQLLQGIQDQMVFLSADPTIKIPTSF 135 >KVH88564.1 HRDC-like protein [Cynara cardunculus var. scolymus] Length = 219 Score = 52.0 bits (123), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIP 135 CLMDCEAA+ILQGIQ+HMV LS D IKIP Sbjct: 99 CLMDCEAAQILQGIQEHMVLLSKDPTIKIP 128 >XP_011658100.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X1 [Cucumis sativus] XP_004134991.2 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X1 [Cucumis sativus] XP_011658101.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X1 [Cucumis sativus] XP_011658102.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X1 [Cucumis sativus] KGN49020.1 hypothetical protein Csa_6G510870 [Cucumis sativus] Length = 220 Score = 52.0 bits (123), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAA++LQGIQD MV LSAD IKIP F Sbjct: 107 CLMDCEAAQLLQGIQDQMVFLSADPTIKIPTSF 139 >XP_008440955.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X1 [Cucumis melo] XP_008440957.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X1 [Cucumis melo] XP_008440958.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X1 [Cucumis melo] XP_008440959.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4 isoform X1 [Cucumis melo] Length = 220 Score = 52.0 bits (123), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAA++LQGIQD MV LSAD IKIP F Sbjct: 107 CLMDCEAAQLLQGIQDQMVFLSADPTIKIPTSF 139 >GAU47145.1 hypothetical protein TSUD_379220, partial [Trifolium subterraneum] Length = 205 Score = 51.6 bits (122), Expect = 4e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAA +LQGIQDHMV LS D IKIP F Sbjct: 88 CLMDCEAAVMLQGIQDHMVMLSRDPAIKIPASF 120 >BAT87600.1 hypothetical protein VIGAN_05098900 [Vigna angularis var. angularis] Length = 153 Score = 50.8 bits (120), Expect = 5e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 224 CLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 CLMDCEAA+ILQGIQD MV LS D+ IK+P F Sbjct: 95 CLMDCEAADILQGIQDQMVMLSRDSTIKMPTSF 127 >XP_019263003.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4-like isoform X2 [Nicotiana attenuata] OIT37437.1 dna-directed rna polymerases iv and v subunit 4 [Nicotiana attenuata] Length = 217 Score = 51.6 bits (122), Expect = 5e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -1 Query: 227 TCLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 TCLMDCEAA+ILQGIQ+ MV LS D IK+P+ F Sbjct: 102 TCLMDCEAADILQGIQEQMVVLSEDPAIKLPISF 135 >XP_019263002.1 PREDICTED: DNA-directed RNA polymerases IV and V subunit 4-like isoform X1 [Nicotiana attenuata] Length = 220 Score = 51.6 bits (122), Expect = 5e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -1 Query: 227 TCLMDCEAAEILQGIQDHMVELSADAEIKIPM*F 126 TCLMDCEAA+ILQGIQ+ MV LS D IK+P+ F Sbjct: 105 TCLMDCEAADILQGIQEQMVVLSEDPAIKLPISF 138