BLASTX nr result
ID: Lithospermum23_contig00042965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00042965 (306 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016538193.1 PREDICTED: uncharacterized protein At5g05190 isof... 64 9e-10 XP_016474167.1 PREDICTED: uncharacterized protein At5g05190-like... 64 9e-10 XP_009762270.1 PREDICTED: uncharacterized protein LOC104214315 i... 64 9e-10 XP_009593355.1 PREDICTED: protein ENHANCED DISEASE RESISTANCE 4-... 64 9e-10 XP_016538192.1 PREDICTED: uncharacterized protein At5g05190 isof... 64 9e-10 XP_015062451.1 PREDICTED: uncharacterized protein At5g05190 isof... 64 9e-10 XP_010326895.1 PREDICTED: protein ENHANCED DISEASE RESISTANCE 4 ... 64 9e-10 XP_019066379.1 PREDICTED: uncharacterized protein LOC104649423 i... 64 9e-10 XP_019228861.1 PREDICTED: uncharacterized protein LOC109209876 i... 64 9e-10 XP_019228800.1 PREDICTED: uncharacterized protein LOC109209876 i... 64 9e-10 XP_006339683.1 PREDICTED: uncharacterized protein LOC102601197 i... 64 9e-10 XP_016474166.1 PREDICTED: uncharacterized protein LOC107795969 i... 64 1e-09 XP_009762269.1 PREDICTED: uncharacterized protein LOC104214315 i... 64 1e-09 XP_016481246.1 PREDICTED: uncharacterized protein At5g05190-like... 64 1e-09 XP_015062450.1 PREDICTED: uncharacterized protein LOC107008062 i... 64 1e-09 XP_010326888.1 PREDICTED: uncharacterized protein LOC104649423 i... 64 1e-09 XP_009593354.1 PREDICTED: protein ENHANCED DISEASE RESISTANCE 4-... 64 1e-09 XP_016474165.1 PREDICTED: uncharacterized protein LOC107795969 i... 64 1e-09 XP_009762268.1 PREDICTED: uncharacterized protein LOC104214315 i... 64 1e-09 XP_016481245.1 PREDICTED: uncharacterized protein At5g05190-like... 64 1e-09 >XP_016538193.1 PREDICTED: uncharacterized protein At5g05190 isoform X2 [Capsicum annuum] Length = 965 Score = 63.9 bits (154), Expect = 9e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEQAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_016474167.1 PREDICTED: uncharacterized protein At5g05190-like isoform X3 [Nicotiana tabacum] Length = 965 Score = 63.9 bits (154), Expect = 9e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEPAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_009762270.1 PREDICTED: uncharacterized protein LOC104214315 isoform X3 [Nicotiana sylvestris] Length = 965 Score = 63.9 bits (154), Expect = 9e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEPAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_009593355.1 PREDICTED: protein ENHANCED DISEASE RESISTANCE 4-like isoform X3 [Nicotiana tomentosiformis] Length = 966 Score = 63.9 bits (154), Expect = 9e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEPAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_016538192.1 PREDICTED: uncharacterized protein At5g05190 isoform X1 [Capsicum annuum] Length = 967 Score = 63.9 bits (154), Expect = 9e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEQAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_015062451.1 PREDICTED: uncharacterized protein At5g05190 isoform X3 [Solanum pennellii] Length = 967 Score = 63.9 bits (154), Expect = 9e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEQAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_010326895.1 PREDICTED: protein ENHANCED DISEASE RESISTANCE 4 isoform X4 [Solanum lycopersicum] Length = 967 Score = 63.9 bits (154), Expect = 9e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEQAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_019066379.1 PREDICTED: uncharacterized protein LOC104649423 isoform X3 [Solanum lycopersicum] Length = 974 Score = 63.9 bits (154), Expect = 9e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEQAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_019228861.1 PREDICTED: uncharacterized protein LOC109209876 isoform X2 [Nicotiana attenuata] Length = 980 Score = 63.9 bits (154), Expect = 9e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEPAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_019228800.1 PREDICTED: uncharacterized protein LOC109209876 isoform X1 [Nicotiana attenuata] OIT07419.1 hypothetical protein A4A49_38577 [Nicotiana attenuata] Length = 982 Score = 63.9 bits (154), Expect = 9e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEPAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_006339683.1 PREDICTED: uncharacterized protein LOC102601197 isoform X3 [Solanum tuberosum] Length = 990 Score = 63.9 bits (154), Expect = 9e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEQAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_016474166.1 PREDICTED: uncharacterized protein LOC107795969 isoform X2 [Nicotiana tabacum] Length = 996 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEPAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_009762269.1 PREDICTED: uncharacterized protein LOC104214315 isoform X2 [Nicotiana sylvestris] Length = 996 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEPAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_016481246.1 PREDICTED: uncharacterized protein At5g05190-like isoform X2 [Nicotiana tabacum] Length = 997 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEPAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_015062450.1 PREDICTED: uncharacterized protein LOC107008062 isoform X2 [Solanum pennellii] Length = 997 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEQAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_010326888.1 PREDICTED: uncharacterized protein LOC104649423 isoform X2 [Solanum lycopersicum] Length = 997 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEQAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_009593354.1 PREDICTED: protein ENHANCED DISEASE RESISTANCE 4-like isoform X2 [Nicotiana tomentosiformis] Length = 997 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEPAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_016474165.1 PREDICTED: uncharacterized protein LOC107795969 isoform X1 [Nicotiana tabacum] Length = 998 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEPAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_009762268.1 PREDICTED: uncharacterized protein LOC104214315 isoform X1 [Nicotiana sylvestris] Length = 998 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEPAKVRLVRCPKCENLLPELTDYSVYQCGGC 33 >XP_016481245.1 PREDICTED: uncharacterized protein At5g05190-like isoform X1 [Nicotiana tabacum] Length = 999 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGC 2 MSE AKVRLVRCPKC NLL EL DYS+Y+CGGC Sbjct: 1 MSEPAKVRLVRCPKCENLLPELTDYSVYQCGGC 33