BLASTX nr result
ID: Lithospermum23_contig00042939
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00042939 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP09166.1 unnamed protein product [Coffea canephora] 62 6e-10 >CDP09166.1 unnamed protein product [Coffea canephora] Length = 153 Score = 62.4 bits (150), Expect = 6e-10 Identities = 32/57 (56%), Positives = 41/57 (71%) Frame = +2 Query: 161 PKGKELYPLKYFRFLGGKMVEAIQVVSGKRGSPKVSSSSERVIKHGVAPMDSHRAEA 331 P+ KEL PLKY + +GGKM +Q++S +R SPKV+SS K VAP+DSHRAEA Sbjct: 77 PRKKELSPLKYLKHIGGKMFAVLQMMSPRRCSPKVTSSER--AKPSVAPVDSHRAEA 131