BLASTX nr result
ID: Lithospermum23_contig00042878
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00042878 (257 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH98716.1 Pentatricopeptide repeat-containing protein [Cynara c... 61 6e-09 OAY47628.1 hypothetical protein MANES_06G093300 [Manihot esculenta] 60 9e-09 GAV57839.1 PPR domain-containing protein/PPR_2 domain-containing... 58 6e-08 XP_018505777.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 6e-08 XP_008356624.2 PREDICTED: pentatricopeptide repeat-containing pr... 58 6e-08 JAU19753.1 Pentatricopeptide repeat-containing protein, chloropl... 56 8e-08 JAU89602.1 Pentatricopeptide repeat-containing protein, chloropl... 56 8e-08 XP_018826537.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 1e-07 XP_013650824.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 3e-07 XP_002888986.1 hypothetical protein ARALYDRAFT_476599 [Arabidops... 56 4e-07 CDX73102.1 BnaC06g35500D [Brassica napus] 56 4e-07 XP_008802609.2 PREDICTED: pentatricopeptide repeat-containing pr... 55 5e-07 NP_177599.1 pentatricopeptide (PPR) repeat-containing protein [A... 55 5e-07 XP_016450574.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 7e-07 XP_009616910.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 7e-07 XP_008239957.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 7e-07 XP_010416316.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 7e-07 CDY67064.1 BnaCnng53370D [Brassica napus] 55 8e-07 XP_007210651.1 hypothetical protein PRUPE_ppa019423mg, partial [... 55 9e-07 XP_019223506.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 9e-07 >KVH98716.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 893 Score = 60.8 bits (146), Expect = 6e-09 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 GG+V LSNI A++GQWE+V IR EMKG G+ K+PGWS++ Sbjct: 854 GGYVALSNICADLGQWEEVLKIRTEMKGTGIKKQPGWSYI 893 >OAY47628.1 hypothetical protein MANES_06G093300 [Manihot esculenta] Length = 895 Score = 60.5 bits (145), Expect = 9e-09 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSF 139 G +V+LSNI+A VGQWE+VQ IR MKGAG+ KE WSF Sbjct: 856 GAYVLLSNIYANVGQWEEVQQIRSRMKGAGVRKEAAWSF 894 >GAV57839.1 PPR domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 892 Score = 58.2 bits (139), Expect = 6e-08 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 G +V LSNI AEVGQWE+V IRR MKG G+TKE GWS V Sbjct: 853 GAYVSLSNIRAEVGQWEEVLEIRRLMKGTGLTKETGWSSV 892 >XP_018505777.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Pyrus x bretschneideri] Length = 902 Score = 58.2 bits (139), Expect = 6e-08 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 G +V +SN++A+VGQWE+V IR ++KG M KEPGWSFV Sbjct: 863 GAYVSISNMYADVGQWEEVIKIRNQIKGTDMRKEPGWSFV 902 >XP_008356624.2 PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic-like [Malus domestica] Length = 902 Score = 58.2 bits (139), Expect = 6e-08 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 G +V +SN++A+VGQWE+V IR ++KG M KEPGWSFV Sbjct: 863 GAYVSISNMYADVGQWEEVIKIRNQIKGTDMRKEPGWSFV 902 >JAU19753.1 Pentatricopeptide repeat-containing protein, chloroplastic, partial [Noccaea caerulescens] Length = 149 Score = 55.8 bits (133), Expect = 8e-08 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 G +V LSNI AEVG+WE+V+ R+ MKG G+ K+PGWS V Sbjct: 110 GAYVSLSNILAEVGEWEEVEETRKLMKGTGLQKKPGWSSV 149 >JAU89602.1 Pentatricopeptide repeat-containing protein, chloroplastic, partial [Noccaea caerulescens] Length = 150 Score = 55.8 bits (133), Expect = 8e-08 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 G +V LSNI AEVG+WE+V+ R+ MKG G+ K+PGWS V Sbjct: 111 GAYVSLSNILAEVGEWEEVEETRKLMKGTGLQKKPGWSSV 150 >XP_018826537.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Juglans regia] Length = 892 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 G +V SNI A+VGQWE+V IR MKG G+ KEPGWSFV Sbjct: 853 GAYVSFSNICADVGQWEEVLKIRSLMKGTGVKKEPGWSFV 892 >XP_013650824.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic-like [Brassica napus] Length = 359 Score = 55.8 bits (133), Expect = 3e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWS 142 G +V LSNI AEVG+WE+V+ R+ MKG G+ KEPGWS Sbjct: 320 GAYVSLSNILAEVGEWEEVEETRKLMKGKGVEKEPGWS 357 >XP_002888986.1 hypothetical protein ARALYDRAFT_476599 [Arabidopsis lyrata subsp. lyrata] EFH65245.1 hypothetical protein ARALYDRAFT_476599 [Arabidopsis lyrata subsp. lyrata] Length = 717 Score = 55.8 bits (133), Expect = 4e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 G +V LSNI AEVG+W++V+ R+ MKG G+ KEPGWS V Sbjct: 678 GAYVSLSNILAEVGEWDEVEETRKLMKGTGVQKEPGWSSV 717 >CDX73102.1 BnaC06g35500D [Brassica napus] Length = 899 Score = 55.8 bits (133), Expect = 4e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWS 142 G +V LSNI AEVG+WE+V+ R+ MKG G+ KEPGWS Sbjct: 860 GAYVSLSNILAEVGEWEEVEETRKLMKGKGVEKEPGWS 897 >XP_008802609.2 PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Phoenix dactylifera] Length = 893 Score = 55.5 bits (132), Expect = 5e-07 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 G H+ LSNI A++G+WE+V IR MKG G+ KEPGWS + Sbjct: 854 GTHISLSNISADMGEWEEVLRIRCSMKGGGIKKEPGWSII 893 >NP_177599.1 pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] Q9CA56.1 RecName: Full=Pentatricopeptide repeat-containing protein At1g74600, chloroplastic; Flags: Precursor AAG52351.1 hypothetical protein; 84160-81473 [Arabidopsis thaliana] AEE35614.1 pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] OAP11852.1 OTP87 [Arabidopsis thaliana] Length = 895 Score = 55.5 bits (132), Expect = 5e-07 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 G ++ LSNI AEVG+W++V+ R+ MKG G+ KEPGWS V Sbjct: 856 GAYISLSNILAEVGEWDEVEETRKLMKGTGVQKEPGWSSV 895 >XP_016450574.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic-like [Nicotiana tabacum] Length = 884 Score = 55.1 bits (131), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWS 142 G ++ LSNI+A VGQWE+V IR M+G G+ KEPGWS Sbjct: 845 GAYISLSNIWASVGQWEEVLKIRSSMQGTGIAKEPGWS 882 >XP_009616910.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Nicotiana tomentosiformis] Length = 884 Score = 55.1 bits (131), Expect = 7e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWS 142 G ++ LSNI+A VGQWE+V IR M+G G+ KEPGWS Sbjct: 845 GAYISLSNIWASVGQWEEVLKIRSSMQGTGIAKEPGWS 882 >XP_008239957.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Prunus mume] Length = 885 Score = 55.1 bits (131), Expect = 7e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 G +V LSNI A+VGQWE+V IR +MKG + KEPGWS V Sbjct: 846 GTYVSLSNICADVGQWEEVLKIRSQMKGTDVRKEPGWSLV 885 >XP_010416316.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic-like [Camelina sativa] Length = 893 Score = 55.1 bits (131), Expect = 7e-07 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 G ++ LSNI AEVG+W++V+ R+ MKG G+ KEPGWS V Sbjct: 854 GAYISLSNILAEVGEWDEVEETRKLMKGIGVQKEPGWSSV 893 >CDY67064.1 BnaCnng53370D [Brassica napus] Length = 332 Score = 54.7 bits (130), Expect = 8e-07 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWS 142 G +V LSNI A+VG+WE+V+ R+ MKG G+ KEPGWS Sbjct: 293 GAYVSLSNILAQVGEWEEVEETRKLMKGKGVEKEPGWS 330 >XP_007210651.1 hypothetical protein PRUPE_ppa019423mg, partial [Prunus persica] Length = 518 Score = 54.7 bits (130), Expect = 9e-07 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWSFV 136 G ++ LSNI A+VGQWE+V IR +MKG + KEPGWS V Sbjct: 479 GTYISLSNICADVGQWEEVLKIRSQMKGTDVRKEPGWSLV 518 >XP_019223506.1 PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Nicotiana attenuata] OIT34013.1 pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 884 Score = 54.7 bits (130), Expect = 9e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 255 GGHVILSNIFAEVGQWEQVQMIRREMKGAGMTKEPGWS 142 G ++ LSNI+A VGQWE+V IR M+G G+ KEPGWS Sbjct: 845 GAYISLSNIWASVGQWEEVLKIRGSMQGTGIAKEPGWS 882